Final Submission : Intervenor 54

Document Name: 2015-134.221977.2612152.Final Submission (1jzjs01!).html

Copie envoyée au demandeur et à tout autre intimé si applicable / Copy sent to applicant and to any respondent if applicable: Non/No

Final Submission : Intervenor 54

Document Name: 2015-134.221977.2612150.Final Submission (1jzjq01!).pdf
**** C. ****
[address redacted]
[address available to Commission]
23 May 2016
Ms. **** May­Cuconato
Secretary General
Canadian Radio­television and
Telecommunications Commission
Ottawa, ON K1A 0N2
**** Ms. May­Cuconato

Subject: **** Public Hearing Written Submission ­ CRTC 2015­134 Introduction

1. I, **** C. ****, as an intervener of CRTC 2015­134, am submitting a post Public Hearing Written Submission in support of my oral presentation presented on 13 **** 16.

2. I had the opportunity to observe in person several days of the hearings, in addition to the transcripts. I will note, that due to bandwidth cap limitations in addition to speed and quality of broadband service, regular viewing on my home internet connection was not economically viable on my Bell Wireless home connection.

3. I would first like to thank the Commission panel, and congratulate them on what I view as a successful and insightful hearing where many viewpoints were presented in a professional, fair, and meaningful manner. I will note that there were a range of interests represented including personal, professional, and corporate. The types of users that gave presentations included those with both physical and mental disabilities, individuals, small and large businesses up to large corporations.

4. It was also my understanding that if market forces were working, we wouldn’t need to have this hearing. If the present state of broadband meet subscribers needs, we also wouldn’t need to have this hearing. The unfortunate aspect is that many are presently not satisfied with some combination of speed, price, value, bandwidth, or latency afforded by their broadband service provider.

5. One consideration I would like to correct for the file of record, is Commissioner **** assumption that I lived in Pembroke proper. My physical street address and municipal taxes are paid to the Town of Petawawa, and I have a Pembroke mailing address. In addition, my Bell Central Office (CO) is Petawawa, and I am located 8.3 KM from the Bell Central Office with no plans by Bell to deploy wireline high speed in the near future. In addition, Bell touts the use of a Bell Turbo Hub as a suitable alternative for my home broadband needs. I believe the references 1throughout this document regarding Table 3 and the rate plans afforded to me will further emphasize why Bell would have no present nor future interest in affording my neighbours and myself broadband wireline services despite the Bell company offering telephone voice services to my community.

6. I will note that Commissioner **** is not incorrect in his assumption in that I am close to the City of Pembroke in that I am approximately 1.5 kilometres away from the city/town boundaries in addition to the Pembroke/Petawawa CO boundaries which in my circumstances seem to mirror municipal boundaries, hence my reasoning for not initially correcting said discrepancy when initially stated. I believe I can speak with confidence on the matters of broadband rollouts to both Petawawa and Pembroke, in addition to other communities.

7. In addition, Chairman **** did allude to population density. My residences is situated on a 1.14 acre lot, with houses of similar sized lots beside me, and along the street with similar density.

My residential lot is zoned R1 residential, and to my knowledge the neighbours either side of me likely are.

8. I will also emphasize that Rogers provides poor cellular signal to my community making their network barely usable for cellular and/or broadband use noting that I was initially a customer for cellular phone service with Rogers when I initially moved to Petawawa in Feb 2011. I moved to Bell for my cellular needs once my contract was finished noting that the Wireless Code had not yet been implemented and it is of my opinion that Bell is the dominant provider of services in my community.

9. Xplornet does not, and to my understanding has never offered terrestrial wireless to my community. In addition to the Bell Wireless Hub, my household did subscribe to Xplornet Satellite from approximately May 2012 until May 2013. Costs were approximately $100 for 100 gigs of bandwidth under a Business plan that may have had an EORN discount applied. **** Satellite service was not usable for VPN use for my wife’s work due to latency, and additionally was unreliable and regularly dropped connection during intensive uses. Further to this, weather was a limiting factor, including light rain and moderate wind.

10. Due to advertising within my community, I did call Xplornet in 2014 to express interest in their newer Wireless LTE offerings noting our household’s previous failures with Xplornet satellite.

Xplornet caller support stated to the effect that as part of their company policy, they would send a installation technician to do a site survey. Should I not be found suitable for wireless, they would automatically install a Xplornet Satellite dish, or I would be forced to pay a contract cancellation fee.

1 CRTC **** ID 701360, Response from Bell regarding complaint [27/29 Apr/01 May 15] https://drive.google.com/file/d/0BwEjDkzP4A3qYmdtM05zU1ZiWlk/view?usp=sharing11. Obviously pressured by the high sales tactics, and offended the company would force unusable technology onto my household I stated my reasoning for refusal of their terms is that Xplornet Satellite provides too high a latency for my requirements to no effect. I was offended that Xplornet would charge my household not to afford service thru some sort of fee they called a “site survey fee”. I also privately noted it would be unlikely that I would be able to get wireless service, as I know over 16 neighbours quite well within my community, all sharing the challenges of broadband, and none have Xplornet Wireless.

12. To close my introduction, I would like to outline some of my observations and viewpoints on the discussions I observed in person and thru Commission transcripts as a part of CRTC 2015­134.

BELL DEFERRAL ACCOUNTS

13. While not a specific topic as part of this hearing, I felt it appropriate to bring forth the examination of the Bell Deferral Account broadband rollout for what I believe to be justifiable reasons in terms of examining the lessons learned and similarities of past broadband rollouts, to include effects and to what the Chairman may have later alluded to as “unintended consequences”. I had no expectation that my allegations detailed in ​CRTC **** ID(s) 7013060, 722533, and 728559​ would be resolved in this hearing. Additionally, this hearing provided new considerations/evidence for the Commission detailed in this document to consider as a part of said case ID’s. However, I felt it appropriate to consider that the issues detailed in said **** ID’s have a present, and perhaps future effect on the considerations regarding the future of broadband in detailed communities.

14. I will emphasize a key consideration surrounding my allegations. Whenever possible, I have provided references and/or evidence supporting my allegations along with substantiating references that the Commission upheld, decided upon, or ruled upon. In many cases, what I have outlined as part of my Bell Deferral Accounts **** ID’s is a wilful failure of Bell follow the Commission's directions and rulings. This is a serious matter if proven true. I ask the Commission to consider evidence, and not just statements from all parties regarding my allegations.

15. The Deferral Account funds were to be used in the public interest, and not for Corporate gain. In my allegations I believe that the Deferral Account funds have been at minimum inappropriately used, if not fraudulently used when leveraged with grant funds. The matter of if any parties committed an illegal act may also be decided upon at a later date through court processes.

16. One issue of strong concern is the aspects of grant stacking and/or double dipping. In a simplistic assessment as referenced in CRTC 2010­637, the difference between award cost detailed, and the overall cost estimate is $157.3 million or 33.9% of the total cost. I am additionally noting 2 3that Bell reported Wireline deployments only to 4 communities as part of the quarterly reporting of the Bell Deferral Accounts rollout. That would effectively mean that Bell was allocated 4 566.1% in direct funding through the Commission, with 33.9% to be afforded using Corporate funds. 6

17. Under the subsidy afforded by EOWC/EORN, it seems to be generally accepted that funding was awarded on a ⅔ basis to broadband service providers, and as expanded upon later in this 2 CRTC 2010­637, Para(s) 36, 41, 42 [31 Aug 10]

3 This is noting the difference of the total cost estimate of $463.6 million, and the allocated/fixed amount set by the Commission of $306.3 million.

4 ​Telecom Decision 2010­637, Follow up to CRTC 2008­1, Para 3 [31 Jul 12] 5 ​Deferral Account­Funded Broadband Expansion Program ­ Reply to Commission Staff Letter, Para 7 [17 Jun 13]

6 ​Request to Commission Review, Rescind and **** DSL Technology Directive in CRTC 2010­637, Para 26 [08 Oct 10]

https://drive.google.com/folderview?id=0BwEjDkzP4A3qfmJ0bkMwbEpvYmViWW9kdEdBakJQbVN4XzdRVjB4TGNuOEIyYVZLWWZHRUk&usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qfmJ0bkMwbEpvYmViWW9kdEdBakJQbVN4XzdRVjB4TGNuOEIyYVZLWWZHRUk&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qR2c5RWtUSUpYV2c/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNGtaMFpxbjVqZms/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qUE5LMlBQNEFvdGc/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qUE5LMlBQNEFvdGc/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharingdocument, EORN maintained a 51% financial interest in hardware that provided services. In the most simplistic form of consideration, 66.1% plus 66.6% equals a potential 132.7% subsidy to Bell of non­corporate funds if grant funds entered a Deferral community. In effect, there is the strong potential that if my allegations are proven, Bell may have actually profited from the receipt of taxpayer grant funds and Deferral Funds on hardware rollout without even considering subscriber profits.

18. I also feel it is important to apply the Deferral and taxpayer grant funding percentages of the **** and Greenstone Project. While the project’s percentage of funding (Armstrong and Greenstone project) referred to in ​CRTC **** ID 728559 ​is not available, it is important to note that broadband grant funding went to Bell to provide DSL services to Nakina and Aroland to afford service to those not served and/or underserved. Curiously, Nakina was reported by Bell to be afforded DSL services through Deferral funds in 2011. 7

19. I ask the Commission to consider the effects of what happened in a broadband rollout they oversaw, including those left under served, or in a disadvantaged position regarding rates and service, to include the consideration that with a disadvantaged subscriber comes an advantaged Corporation and enriched shareholder. My allegations can be summarized by the fact that the public interest was not upheld, and potentially tens to hundreds of millions of taxpayer dollars and/or deferral funds have been misused and/or wasted.

20. What I ask the Commission to further consider, is that if my allegations are proven true, and indeed its rulings and decisions were ignored, how does the Commission maintain its relevancy with regards to its future rulings and decisions? My comment is not meant as a slight towards the Commission, who I believe has and will act in the public interest, but rather a call for strong actions against any Company and/or organizations that may choose to wilfully ignore the decisions and rulings of the Commission in accordance with its lawful mandate.

21. I also ask the Commission to consider the names of the signatories of each of the Bell Deferral Accounts document submissions over about a decade. There are numerous signatories of high ranking individuals within the Bell conglomerate of Corporations on said documents, including individuals who are now at the top echelons of the Bell corporate structure. These individuals gave their literal stamp of approval and acknowledgement to the events I am detailing. Some of the signatories have even spoken before the Commission.

22. My allegations regarding Bell’s actions, if proven true, demand strong punitive and administrative actions to be taken against the company to maintain the public trust, and protect the public interest. In addition, noting the percentages of funding I detailed above, my allegations may transition to a criminal investigation if taxpayer funds were used to benefit a corporation in the manner I described.

7 Letter to Mr John Traversy from Mr. **** Daniels, Para 3 [31 Jul 12] https://drive.google.com/folderview?id=0BwEjDkzP4A3qekM2VjhLbHhEbFE&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNGtaMFpxbjVqZms/view?usp=sharing23. Additionally, is the effects of the Bell Deferral Accounts broadband rollout on grant funding, noting additionally the rates detailed in Table 3. Bell has detailed its reporting to Industry Canada regarding Bell Deferral Accounts Wireless rollouts has served to cause some communities to be labeled as served, and therefore caused them to become not eligible for grant funding despite there being some pockets of underserved or un­served Canadians. The emphasis is on some, in that said practices of selectively serving Canadians may be a disadvantageous practice under the objectives of the Telecommunications Act. Any example of said reporting would by my own Bell Distribution Serving Area (DSA), which is not served by Bell Deferral Accounts, nor Bell wireline despite reporting to Industry Canada otherwise as part of its all encompassing HEX­ID classification system. 8

24. Additionally, I have examined only a few Deferral communities, and noted issues with the CRTC broadband rollout map. I am presently looking for the fixed wireless service afforded by Bell as 9part of the Deferral Accounts rollout in deferral communities of Cartier, and MacDiarmid. **** communities are now listed as under served, and eligible for grant funding despite their rollouts being directed in CRTC 2007­50 as CO (rather than DSA) based rollouts. **** detailed communities are just a small selection of Deferral communities that curiously may not have been well served by the Bell Deferral Accounts rollout, or may be inefficiently targeted in the future for additional broadband grants.

25. In closing to my opening statements regarding the Bell Deferral Accounts, further issues will be detailed in this document surrounding the rollout. Once again, I strongly urge the Commission to consider past effects of grant funding and Bell Deferral Accounts to communities, to include leverage gained and effects on the marketplace. I will note that not in all cases have the effects been positive, nor have taxpayer dollars and non­corporate funds been spent appropriately in a manner that emphasizes the public interest.

8 HEX­ID Assessments, and the issues surrounding them are detailed in CRTC **** ID 701360 9 ​http://www.crtc.gc.ca/eng/internet/internetcanada.htm

http://www.crtc.gc.ca/eng/internet/internetcanada.htm

Comments from constituents of **** Linau​, Part of file of Record CRTC 2015­134 1. My Family uses the internet to work from home, attend online school, and daily email and other casual internet activities. We are disappointed in the availability, speed, and quality that our ISP is providing against what we are paying for. I know that my grandparents in Toronto and Kitchener pay $10­$20 less than us for almost double the speed, monthly usage, and is always reliable with no black outs. We love living and working in the Campbellville/Milton area and I know my family would like to stay here, but because the internet is such a big part of our work and education we are seriously thinking of moving because of this. I know I am not the only one in this boat as I have been working in the Campbellville area and have talked to other residents who area of the same opinion. It seems like every year we are promised better service and that someone is working on fixing this problem. Unfortunately this story has gotten old we don't really believe any good news that we hear anymore. It is also hard to believe the in an area such as Campbellville/Brookville where so many wealthy people live, the ISPs don't care enough to provide acceptable service. We really appreciate that you (Cindy ****) are taking initiative and are trying to do something do fix this pressing issue.

2. Our only options are Satellite or cellular hub. The Explorernet satellite is terrible..that only leaves cellular and reception in the campbellville area is poor. Telus is our best reception but bell has a 10GB plan that seems to fit our needs. We have tried both and they work ..but it sure would be great to have access to really good internet

3. I have been using internet for over 10 years. My service has evolved (barely) from rotary dial to what Bell laughingly calls high speed in the Campbellville area. Rural service is very low on Bell's priority list, but their revenue is at the top of their list. I'm not optimistic, but thank you for trying to improve internet service here.

4. Although I'm on DSL, the internet is interrupted frequently every day. The speed is probably better than most people have in Campbellville, but compared to Milton it's still pathetic. Cable can move higher internet speed over longer distances than DSL. I have asked Cogeco many times to put their cable through to our street. They keep telling me that their priority is not Campbellville because Milton is growing so fast, they need all their manpower in Milton. That seems terribly unfair! How can we get Cogeco to expand their cable network throughout Campbellville?

5. Business in the Campbellville area can't conduct a professional service with the lack of reliability

6. We have always had spotty service, and I spend a fortune on cell phone bills because our home internet turns itself on and off so our phone keep switching from home wifi to 3G randomly and the bills are astronomical. We try to watch movies on Netflix, etc and it's constantly interrupted by the wifi having to be re­booted. We consider our wifi terrible. We are with Bell, however everyone I speak with in Campbellville has the same weak internet service with any provider.

7. If we cannot get better internet­ we will be moving. The internet is no longer a luxury item­ it is a necessity. My children are unable to do their homework anymore­ even the Brookville teachers do not have a true appreciation of the speed of our internet. The MDHS teachers REALLY don't understand. My children need to learn how to use technology ­ but they are simply frustrated at this point. Presently, the education system relies on the internet­ and if we cannot improve its speed, then we must move. It's not fair to my kids.

https://drive.google.com/file/d/0BwEjDkzP4A3qTU5uR19qQ0d4aDA/view?usp=sharing8. All I want is high speed with unlimited usage like most of ontario gets. If we need to upgrade software, we go to macdonalds in acton or to the acton library. Or go to work (u of Guelph) and do it there. Otherwise it takes literally HOURS and we hope the connection holds 26. I am going to ask the Commission to consider the complaints from the residences of Campbellville as a serious issue to be considered. Campbellville (DSA 184­1) is the Central Office (CO) name of Milton, a Bell Deferral Community as outlined in CRTC 2008­1. DSA 184­1 appears to encompass Brookville and Darbyville as a part of Campbellville. In addition, bordering Campbellville, and potentially a part of Milton is the Deferral CO of **** of which a total of 7 DSA’s are detailed in CRTC 2008­1

27. Many of the constituents of **** Linau are complaining of receiving low caps such as 10 gigabytes on cellular, and are likely not aware the Bell Wireless 5 plan, nor the Bell Deferral Accounts. Nor was Mrs. **** Linau aware of the Bell Deferral Accounts when I spoke to her recently through email.

28. The issue of the obfuscation of Bell Deferral Accounts plans was an issue alluded to, and responded to by Bell as a part of CRTC **** ID 701360. Bell received funds for each of these residences, and was to provide a service near exacting to DSL both in quality of service, and rate plans thru wireless. I will note, at least one of the complaintants is requesting unlimited usage, or perhaps bandwidth insurance, something that is not offered as part of any form of Bell Wireless including Bell Deferral Accounts plans.

29. In addition, is the consideration of the issue of the leverage of wireless boundaries using Deferral Towers. In the case of DSA 184­1 (Campbellville), does the wireless range of the Bell Deferral tower extend beyond the boundaries of DSA 184­1? Should subscribers who are afforded broadband through said tower be afforded other rates as detailed in Table 3 of this document in a manner that I consider to be disadvantageous, and amounting to undue preference and marketplace leverage across both residential broadband and mobile obtained by Bell?

EOWC / EORN PRESENTATION
CRTC 2015­134, Hearing Transcripts [12 Apr 16]

2800 Having achieved our objective of delivering speeds of 10 megabits per second download and 1 up, to more than 90 percent of the Region in 2014, we recognize the need for ongoing investments to meet the growing demands of our residents beyond our current speeds and our current capacity.”

30. I beleive that EORN is overstating its accomplishments.
http://www.crtc.gc.ca/eng/transcripts/2016/tt0412.htm

31. I would like to ask the Commission to consider that the Bell Fibre To The Node (FTTN) that is likely being referred to be EORN is a best effort service based on distance from the node as part of a copper loop. To emphasize this, FTTN comes with the same limitations as other forms of VDSL2 and otherwise referred to generically as DSL. There are likely those close to the node who can achieve 25 Mbps download and substantial upload speeds, in addition to those who receive less than 5/1. 10

32. EORN also provided grant funds to Bell for CO based upgrades to VDSL2, and FTTN 11technology to both Deferral and non­deferral CO’s. **** DSL technology affords a best effort DSL service with a range of speeds afforded to DSL. In effect, all FTTN does is bring a smaller, typically fibre fed and electrically powered, “Central Office” closer to the community to be served. This in effect re­sets the distances of DSL, and when used in conjunction with VDSL2 technology offers some advantages in terms of speed.

33. In addition, the Commission should consider CRTC **** ID’s 721846 and 722211 where each residence in Deferral DSA Pembroke 403­0 were afforded broadband wholly thru one of of EORN’s grant funded FTTN as wireless was not available to many parts of said Deferral DSA.

The Commission should consider that said case ID’s did not afford 10 megabits per second download, and instead had reported speeds of far less than 5 megabits per second.

2859 MR. FELL: The provincial government contributed $55 million. The federal government contributed $55 million and that was through Infrastructure Canada funding at the time. I believe we were the only broadband infrastructure project in that. It's typically used for roads and bridges and things like that. And it was a two­thirds, one­third matching formula. So when we went out to the market, we needed to raise a minimum of a third from the private sector and we were absolutely able to do that.

2860 The total cash in­kind value of the project is $175 million but with the in­kind and fiber assets that were added in by the private sector, we valued the total project in the region at about $260 million.

2870 And then we always knew that some of the residents in the most rural remote areas would not be able to be reached by a terrestrial solution. So we negotiated a $10 million agreement with Xplornet for satellite capacity in the region.

34. I would like to note the above stated responses detailed financial information that is underreported by millions of dollars from EORN’s financial statements. For example, A PDF summary created by Mr. **** Adams of EORN financial statements, to include reference 10 Refer to CRTC **** ID 722211 & **** ID 721846 for details of EORN grant funded nodes that afford services to these residences in Pembroke DSA 403­0 (A Bell Deferral DSA) 11 ​North Frontenac Minutes, Para 4 & **** 18 [25 Nov 13]

https://drive.google.com/file/d/0BwEjDkzP4A3qUmJ6WHVkdlU5cWs/view?usp=sharingdocuments can be found at the footnote reference folder. Examples include $15,394,001 12allocated for Satellite access, and the under reporting of revenues by approximately $2 million.

35. I will note that without accurate reporting on financial numbers, the Commission has a difficult time gauging future cost projects based on past experience.

2848 We entered into a joint agreement. The Wardens Caucus did and they formed EORN as the organization that would be the delivery mechanism for this project.

The most serious of Mr. Adams' allegations relate to the use of funding provided by EOWC and purportedly EORN to Bell Canada and Bell Aliant (as it then was) as it relates to deferral areas in Eastern Ontario. Any funding supplied was supplied by EOWC under contract with Bell Canada and Bell Aliant, either its own funds or funding received from the Government of Ontario and the Government of Canada. EORN itself supplied no funding whatsoever to either Bell Canada or Bell Aliant in connection with the construction of any broadband back haul networks or so called "last mile" networks or other infrastructure. EORN's role is limited to being a contract manager on behalf of EOWC of its contracts with Bell Canada, Bell Aliant, now Bell Canada and other ISP's.

13

36. I assess the above statement as being contradictory to EORN’s financial statements. As per EORN financial statements, it appears that the EORN board of directors was in charge of 14substantial funds, to include loans and payments received from the EOWC.

37. I will also note that “EORN receives fees from providers as a contribution to governance to subsidize marketing outreach activities.” This outlines the issue that EORN may be directly or 15indirectly profiting from the provision of services in Bell Deferral Accounts DSA’s to include affording Bell a level of subsidization through grant funds.

38. This point is very important to consider: what are EORN’s present business interests in Deferral DSA’s to include fees received through the provision of services?

39. I ask the Commission to consider what is accurate and applicable in terms of agreements between EORN, EOWC, and Bell noting that typically within Corporate law, a parent company (EOWC) may not be held to account for decisions and/or agreements made by its subsidiary company and/or vice versa.

40. In addition, I ask the Commission to consider the Federal/Provincial government grant stacking rules noting that EORN as listed as a grant recipient of Federal Government grants as detailed in 12 Folder Link EORN Financial Statements, 2011, 2012, 2013, 2014, 2015 [assorted dates] 13 CRTC 701360, EOWC & EORN Response to Mr ****, **** 2 [29 Sept 15] 14 Folder Link EORN Financial Statements, 2011, 2012, 2013, 2014, 2015 [assorted dates] 15 **** Regional Broadband Feasibility Study, Para 6.1.1.4, **** 141 [updated May 14] https://drive.google.com/folderview?id=0BwEjDkzP4A3qYy01RnJQaWJaLWM&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qYy01RnJQaWJaLWM&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qUklKaGp5WmJIcnM/view?usp=sharingthe Public Accounts of Canada Summary Report and Consolidated Financial Statements Volume I [assorted years], and that EOWC is listed as a grant recipient of Provincial Government grants as detailed in the Public Accounts of Ontario Detailed Schedules of Payments Vol 3 [assorted years]. 16 17

41. Did grant stacking occur through a method of applying for funds from the Province under EOWC, and from the Federal Government under EORN? A very serious consideration consideration for the Commission, the Auditor General, and Ontario Ombudsman: what would be the reason for receiving funds under two separate corporate names?

42. I also ask the Commission to consider why EORN has indicated it has received $55 million from the Federal Government, noting a comparison between Public Accounts of Canada Summary Report and Consolidated Financial Statements years 2014 and 2015 noting the abrupt change in payment schedule. As per year 2014, EORN was supposed to be paid the corporation’s outstanding obligation of $27 million in 2015. However, this changed in 2015, when EORN 18was detailed to be paid far smaller sums of approximately $7 million a year until 2017. 1943. I will also further note, these numbers appear to contrast quite differently compared to the EORN Financial Statements detailed, whereby it appears that EORN has been paid its full amount from the Federal Government. 20

2885 MR. EMON: A more recent example for us was when the world kayak championships came to Beachburg, which is the Whitewater Region just up the Ottawa River about 70 kilometres west of here. And there wasn’t enough capacity nor a tower close by and we had to bring in a portable tower to be able to broadcast it worldwide.

44. I would like to note that Mr Emon has previously spoken regarding this matter in an email communication with Mr. **** Kenny, who noted the requirement “to erect a temporary cell tower at the competition site of the World Kayak Championships.” 2145. I would like to ask the Commission to consider that that 2015 World Kayak Championships was run in Beachburg at the business known as Wilderness Tours. 2246. Noting that there is a reported lack of capacity by Mr Emon for said event, I would like to ask the Commission to consider that Cogeco serves the Whitewater Business Park as part of EORN’s 16 EORN Financial Statements Summary, created by Mr. **** Adams, **** 4 17 Federal & Provincial Financial Statements ­ EORN ­ EOWC, file folder [assorted years] 18 ​Public Accounts of Canada Summary Report and Consolidated Financial Statements, **** 316, Eastern Ontario Regional Broadband Network [31 **** 2014]

19 ​Public Accounts of Canada Summary Report and Consolidated Financial Statements, **** 315, Eastern Ontario Regional Broadband Network [31 **** 2015]

20 Folder Link EORN Financial Statements, 2011, 2012, 2013, 2014, 2015 [assorted dates] 21 Municipal Corporation of the County of Renfrew, Development and Property Committee, Appendix ED­I, PDF **** 20 [emails dated 13 Aug 15 & 14 Aug 15]

22 ​http://www.worldfreestylekayakchampionships.com/​ [as viewed 20 Apr 16] https://drive.google.com/file/d/0BwEjDkzP4A3qbHhPVE1aUF9XblU/view?usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qVUI1ME5uZnBYZzg&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qSWNBdm1Kd3FGV0k/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qSWNBdm1Kd3FGV0k/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qSWNBdm1Kd3FGV0k/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qcjhLV0poUEZOc1U/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qcjhLV0poUEZOc1U/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qcjhLV0poUEZOc1U/view?usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qYy01RnJQaWJaLWM&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qSzBkRVNmTVlyZEk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qSzBkRVNmTVlyZEk/view?usp=sharinghttp://www.worldfreestylekayakchampionships.com/

rollout with fibre directly to the business park including the specific business of Wilderness Tours as detailed in EORN’s 2014 Final Report. I will note that Wilderness Tours described the fibre rollout as a “game changer” in said report. 23

47. How is it that with fibre directly to the business, there is still a reported capacity shortage after EORN’s rollout? How was a portable tower required to broadcast the event worldwide considering said fibre to the business deployment that EORN enabled?

48. In addition, is the noted aspect of rental of a portable tower with the assumption that it provided broadband services or capacity of a cellular nature at cost to EORN or another organization. It should be noted that I believe that Wilderness Tours is located inside Cobden DSA 285­1 as part of CRTC 2008­1 ­ Bell Deferral Accounts rollout. **** DSA was to be afforded service using 24HSPA+ wireless as reported to the Commission as part of Bell’s quarterly reports. ​ An 25additional advantage touted by Bell was the broad mobile coverage that would be provided to the DSA. 26

49. How is it possible there wasn’t a suitable tower situated to afford wireless coverage in a Bell Deferral DSA noting that thru research, there doesn’t seem to be a Bell cellular tower located within or near the Deferral DSA, but rather somewhat closer to the Cobden CO, and perhaps more suitably placed to serve Hwy 17 and built up areas of Cobden? 2750. In addition to and further easing the burden on Bell’s advanced cellular/broadband HSPA+ network, it is noted there is a EORN grant funded node located at the detailed Lat/Long Coordinates as per Attachment A to include the DSA markings of “285­1” located on the box.

51. The inclusion of the EORN grant funded DSL node ought to have further lessened the burden on whatever coverage the Bell HSPA+ dual use cellular has within the DSA when coupled with its Fibre To The Business rollout to Wilderness Tours.

52. Noting the involvement of potentially millions of dollars of taxpayer funding, grants, and deferral accounts funds in one Bell Deferral DSA, how is it possible in the above mentioned community there is a reported cellular broadband capacity shortage? In addition, how was there a capacity shortage noting an EORN funded fibre to the business premises provision?

53. I believe that Attachment A to this document amplifies my concerns with Mr. Emon’s statement.

Based on the details I have provided, I believe the Mr. Emon’s above stated requirement may require amplification and/or clarification from both EOWC/EORN and Bell regarding the information I have detailed noting the issues presented in CRTC **** ID 701360.

23 EORN Final Report, **** 28 [2014]
24 Bell Deferral Accounts map, NPA 613 Map 2

25 Letter to Mr John Traversy from Mr. **** Daniels, Para 3 [31 Jul 12] 26 Assorted submission by Bell ­ Bell Deferral Accounts Rollout file & CRTC 2015­134 27 ​www.ertyu.org​ [as viewed 20 May 16]

https://drive.google.com/file/d/0BwEjDkzP4A3qNVFNQnhELVozZDg/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNGtaMFpxbjVqZms/view?usp=sharinghttp://www.ertyu.org/steven_nikkel/cancellsites.html?lat=45.693690&lng=-76.750948&zoom=11&type=roadmap&layers=b&pid=0http://www.ertyu.org/steven_nikkel/cancellsites.html?lat=45.693690&lng=-76.750948&zoom=11&type=roadmap&layers=b&pid=03096 So different technologies, Fibre to the home tends to provide a better quality of experience, satellite has latency, so we do get a lot of feedback.

54. I would like to inquire when EORN oversaw a fibre to the home (FTTH) deployment that the Corporation can comment on? **** EORN maintain 51% interest in any FTTH deployments within its territory noting that wholesale access was only recently enshrined within FTTH deployments?

55. What conflicts or barriers would face EORN in FTTH deployments using both in communities it afforded FTTN to Bell Deferral communities/DSAs, and non deferral communities noting that EORN has detailed a 7 year financial interest in hardware the Corporation funded to communities.

56. **** said long term financial interest and/or agreement with Bell or any other telecommunications provider inhibit the upgrades of EOWC/EORN communities from FTTN to FTTH, with a specific emphasis on Bell FTTH?

57. The above statement notes the ownership of assets described in that the EOWC will maintain full ownership of 51% of the built capital assets until 31 Aug 17, and then transferred to the proponent for an additional 7 years. **** said EORN long term contract, until 2024, limit 28 29any potential upgrades to FTTH until 2024?

BELL PRESENTATION
CRTC 2015­134, Hearing Transcripts [19 Apr 16​]
Quote above ­ Response from Mr. **** below

9436 THE CHAIRPERSON: You probably were listening in or somebody from your company was listening in when Mr. **** Adams came to the proceeding. And he had issues with how services were extended in certain communities. What do you say to Mr.

****?

9437 MR. GAUVIN: There’s a fairly extensive record on the dispute with Mr. **** ****. I think a lot of the dispute stems from confusion and understandable confusion between the differences and boundaries with the DSA, telephone exchange, a wire centre, a community, and how each are actually funded, sorry, by EWOC or the deferral accounts, and where people actually are.

9438 So if you’re in a certain community, what’s funded by the deferral account might actually not be the entire community, but certain exchanges or DSAs. Similarly, EWOC might fund certain portions.

28 **** Regional Broadband Feasibility Study, Para 6.1.1.4, **** 141 [updated May 14] 29 **** Regional Broadband Feasibility Study, Para 6.1.1.12, **** 145 [updated May 14] http://www.crtc.gc.ca/eng/transcripts/2016/tt0419.htm

https://drive.google.com/file/d/0BwEjDkzP4A3qUklKaGp5WmJIcnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qUklKaGp5WmJIcnM/view?usp=sharing58. I would like to emphasize to Bell that I have provided evidence using maps submitted by Bell, maps from EOWC, and Lat/Long Coordinates. In addition, where available I have provided an indicator of timeline of build using Google **** view and Satellite view, and demonstrated terrain and boundary features analysis in my map comparisons. All evidence has been gained through the use of open source mediums, and on occasion, official requests through appropriate channels. In turn, I have open sourced all compiled details.

59. In the vast majority of cases, it is clear what nodes I am referring to by Lat/Long coordinates. In addition, the shaped DSA boundaries and landmark features appear very similar if not exacting in comparison.

60. Regarding the alleged confusion of boundaries of DSA’s, I would like to point out Attachment A to this document (to include the embedded hyperlinks within each picture and diagram), where I provide a picture of a EORN funded node located in the Deferral Central Office of Cobden.

Clearly indicated on Attachment A is a zoomed in section of said picture that I took, indicating the DSA of 285­1 on the copper splice box. I will emphasize, the markings and the box belong to Bell, and it is highly doubtful they are random numbers.

61. In addition, I will note the earlier statement regarding spotty cellular coverage in a Coben Bell Deferral DSA, and supporting evidence to show a lack of a cellular tower within said DSA.

9440 MR. GAUVIN: ​And if there’s overlap, then there’s some true up that has to be done. And that actually happened because the timing of the deferral account and the EWOC funding was overlapping. So we had actually won some funding from EWOC and then got the deferral account funding.​ And what happened is we actually cut cheques back to EWOC based on where we had funding from the deferral account.

62. I will comment on the highlighted statements. Bell’s statements with regards to timing sharply contrast with the timeline I will indicate as per Table 1:

Table 1
Document Date
CRTC 2007­50 06 Jul 07
CRTC 2008­1, Appendix A 17 Jan 08
CRTC 2009­763, **** 9 ­ 16 09 Dec 09

EOWC Transport Fibre Ring Backbone Map, Legend, Map Revisions ­ No 1 ­ Added Deferral Account DSA’s

20 Jan 10

https://drive.google.com/file/d/0BwEjDkzP4A3qM0p0b0NkM3czTkk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qMjZuTFk2WWpXUzQ/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qUFI0c1NXN050Unc/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharingEOWC Transport Fibre Ring Backbone Map, Legend, Map Revisions ­ No 4 ­ Added Deferral Account DSA’s

07 May 10

Document from solicitors for Eastern Ontario Wardens’ Caucus and Eastern Ontario Regional Network as part of CRTC **** ID 701360 [29 Sept 15] “EOWC entered into a contract with Bell Canada and Bell Aliant Regional Communications Limited Partnership ("Bell Aliant") dated **** 27, 2010 for the construction of a high speed broadband internet network within the EOWC territory which is a fiber optic backbone and back haul transport network.” [Page 2]

27 Aug 10

EOWC Transport Fibre Ring Backbone Map, Legend, Map Revisions ­ No 7 ­ Added Peterborough / Smiths **** OME Photonics revisions

31 Jan 11

Public Accounts of Canada, Volume 1, Summary Report and Consolidated Financial Statements: EORN Received its first 12 million of a budgeted 55 million from Federal Government [Page 288]

**** Year Apr 2011
to Mar 2012

63. In the above stated timeline, it appears that Bell would have known that the DSA’s it bid on as part of funding were actually submitted Deferral DSA’s in addition to the EOWC, particularly when it is considered that the EOWC Transport Fibre Ring Backbone Map was a joint submission.

64. I would like to note to the Commission that typically a backhaul contract would be afforded prior to a last mile contract for what is referred to as “points of presence” (likely referring to FTTN).

The reasoning for this is likely because of the consideration that last mile requests for proposals leading to service contracts would be dependant on the open access to EORN/Bell backbone network by companies other than Bell.

65. In addition, it should be noted that Bell claims the company “won some funding”. I would like to outline that Bell would have likely responded to a request for proposal. To emphasize, Bell would have applied for funding making said application wilful, and deliberate.

66. I would like to comment on Bell’s statement about “true up” noting that said process isn’t necessarily as simple as returning grant funds to the organization that provided funding. Bell’s actions, in the awarding of a double subsidy against the Commission's rulings are highly problematic, and not simply solved. In addition, Bell reported all but 4 communities were to be served by wireless, none of the wireline Deferral communities are within EORN territory.

67. I would like to note that all 3 levels of government contributed to EORN/EOWC making a simple return of funds to EOWC/EORN for redistribution problematic. There is the potential that Municipalities contributed funds to EORN/EOWC expecting a return on their investment in their https://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ1VSYUVBcmFLZ2s/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ1VSYUVBcmFLZ2s/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ1VSYUVBcmFLZ2s/view?usp=sharingcommunities. Municipalities with larger allocations of Deferral DSA’s may have contributed equally as compared to other Municipalities, with little or no return on their investment and little information that their communities were actually to be served with Deferral Accounts.

68. This may present the issue that had municipalities been engaged by Bell, they might not have invested in EORN.

69. In addition, noting the numerous **** ID’s from myself, it appears that the issue at hand is not just limited to EOWC/EORN funding rollouts.

70. I will also note that it took a private citizen to come forward, with extensive research and references, before Bell reported the above stated actions to the Commission. If said comment is an admission, Bell’s prior comments to me thru my **** ID show a level of initial subterfuge.

71. I feel it is important to examine all aspects of the timelines regarding funding, to include the request for proposal dates of issue, responses, and awarding of contracts. This should also include the operational date, and subsequent agreements and business interests.

9440 MR. GAUVIN: ​And if there’s overlap, then there’s some true up that has to be done. And that actually happened because the timing of the deferral account and the EWOC funding was overlapping. So we had actually won some funding from EWOC and then got the deferral account funding.​ ​And what happened is we actually cut cheques back to EWOC based on where we had funding from the deferral account.

72. I will address the matter of cheques to EOWC by bring up assorted points. First I would like to note that the EORN financial statements seem to fail to reflect the exchange of monies. 3073. I would also like to note that EORN/EOWC has addressed the of receipt of payments in a differing manner. Please note the following quotes from EORN/EOWC:

a. “The Recipient has explained that the deferral account funding was used to construct 20 points of presence (POPs) of the EORN fiber backbone and to expand mobile broadband services. The Ontario Ministry of Agriculture, Food and Rural Affairs directed Deloitte to obtain assurance there was no funding overlap with the CRTC deferral account.” b. “Deloitte identified and selected transactions for testing, based on preselected POPs.

Based on our testing, we noted that alI expenses that related to the construction of the POPs that were initially claimed (since the deferral area POPs were identified when the project was already started) were adjusted and subsequently credited from other claims.

Therefore, no POPs expense was identified in any claims tested." 30 Folder Link EORN Financial Statements, 2011, 2012, 2013, 2014, 2015 [assorted dates] https://drive.google.com/folderview?id=0BwEjDkzP4A3qYy01RnJQaWJaLWM&usp=sharingc. “there was no overlap with the deferral account obligations in respect of the construction of the Last Mile Network with Bell Aliant as Bell Aliant did not have an obligation to our understanding under the CRTC Deferral Program to offer broadband services” 3174. I ask the Commission to consider investigating what actually happened, noting that Bell, and the EOWC/EORN should probably consider getting their statements of events synchronized. I believe that accuracy in the statements of all parties is important: was a cheque cut to EOWC, or were there adjustments and credits from other claims?

75. In addition, the statement regarding Bell Aliant not having a Deferral obligation by the solicitors of the EOWC/EORN is incredibly naive. Bell Aliant thru its parent company Bell had clear obligations under the Bell Deferral Accounts. 32 33 34

76. **** differing statements are an important consideration when taking into consideration that the EORN had money left after their project to complete business park fibre rollouts, a project above and beyond their original mandate, and perhaps beyond the purposes of Federal, Provincial and Municipal grant funds for residential broadband. I am referring to the use of taxpayer dollars to provide funding for mainly for business broadband, rather than residential. This issue was raised as a part of CRTC **** ID 701360. 35

77. In addition, I would like to note that not all deferral communities were noted on the EOWC/Bell map. ​ The Pembroke Deferral DSA 111­0 approved in CRTC 2009­763 at ​Lat/Long 45.6907, 36­77.0231​ on Stafford 3rd Line Road located in Micksburg was not identified on the EOWC map as a Deferral DSA.

78. Moving forward from the above mentioned statements, I would like to draw attention to the statement from EOWC/EORN that “deferral account funding was used to construct 20 points of presence (POPs) of the EORN fiber backbone and to expand mobile broadband services.” 3779. Noting that there were only 4 communities reported to be afforded DSL service as part of the Deferral Accounts rollout (Bury, **** Lake, Nakina, and Gogama), I would like to ask the Commission to consider the EOWC/EORN statement of “expanding mobile broadband services”, particularly when considering that the EOWC/EORN and Bell Deferral Accounts broadband rollout seem to be so closely aligned in near concurrent deployment.

31 ​Document from solicitors for Eastern Ontario Wardens’ Caucus and Eastern Ontario Regional Network as part of CRTC **** ID 701360, **** 4 [29 Sept 15]

32 ​Followup to CRTC 2008­1, Reply Comments of Bell, Para 69 [08 **** 10] 33 ​Request to Commission Review, Rescind and **** DSL Technology Directive in CRTC 2010­637, Para 34 [08 Oct 10]

34 ​Request to Commission Review, Rescind and **** DSL Technology Directive in CRTC 2010­637, Para 23 [08 Oct 10]

35 CRTC **** ID 701360, Submission by Mr. **** Adams, **** 64 ­ 68 [31 Aug 15] 36 ​EOWC Transport Fibre System Backbone Map, P­01­2009

37 ​Document from solicitors for Eastern Ontario Wardens’ Caucus and Eastern Ontario Regional Network as part of CRTC **** ID 701360, **** 4 [29 Sept 15]

https://www.google.ca/maps/place//@45.6907887,-77.0228889,3a,75y,230h,90t/data=!3m7!1e1!3m5!1s9B43ofSwJHy-C4o8u7APKw!2e0!6s%2F%2Fgeo3.ggpht.com%2Fcbk%3Fpanoid%3D9B43ofSwJHy-C4o8u7APKw%26output%3Dthumbnail%26cb_client%3Dmaps_sv.tactile.gps%26thumb%3D2%26w%3D203%26h%3D100%26yaw%3D230.44777%26pitch%3D0!7i13312!8i6656!4m5!3m4!1s0x0:0x0!8m2!3d45.6907887!4d-77.0228889https://www.google.ca/maps/place//@45.6907887,-77.0228889,3a,75y,230h,90t/data=!3m7!1e1!3m5!1s9B43ofSwJHy-C4o8u7APKw!2e0!6s%2F%2Fgeo3.ggpht.com%2Fcbk%3Fpanoid%3D9B43ofSwJHy-C4o8u7APKw%26output%3Dthumbnail%26cb_client%3Dmaps_sv.tactile.gps%26thumb%3D2%26w%3D203%26h%3D100%26yaw%3D230.44777%26pitch%3D0!7i13312!8i6656!4m5!3m4!1s0x0:0x0!8m2!3d45.6907887!4d-77.0228889https://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQnF1NXpscmpZWGM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qeUlPTG84WlJ3SEk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qX0U1MlZyVWRxYUU/view?usp=sharing80. In addition, it is stated to the effect that only “20 points of presence” were declared to Deloitte. I would like to ask the Commission to consider that after conducting a map analysis of the EOWC/Bell Rollout map, I have identified 15 Independent Exchange Nodes (likely referring to Bell FTTN) within Deferral DSA’s in addition to 19 Deferral CO’s that appear to be indicated as having received funding for Alcatel 7750 switching equipment as detailed in the map legend. I will also note that EORN has stated some of the communities that received CO based upgrades to VDSL (likely referring to VDSL2 ­ to my knowledge Bell never implemented VDSL/VDSL1 on a large scale). 38

Table 1 ­ Exchange Nodes 39 40
CO Name
Indicated Name
on EOWC Map
Deferral
DSA Type of Hardware
Indicated as
Deferral DSA on
EOWC Map Deferral Map

Petawawa **** Bay Y Exchange Node (Independant ****) Y 613_map2.pdf Pembroke **** Y Exchange Node (Independant ****) Y 613_map2.pdf Pembroke Micksburg Y Exchange Node (Independant ****) N 613_map2.pdf Cobden Foresters **** Y Exchange Node (Independant ****) Y 613_map2.pdf Cobden Barryvale Y Exchange Node (Independant ****) Y 613_map2.pdf Plevna Ompah Y Exchange Node (Independant ****) Y 613_map3.pdf Plevna Ardoch Y Exchange Node (Independant ****) Y 613_map3.pdf Plevna Fernleigh Y Exchange Node (Independant ****) Y 613_map3.pdf Denbigh Griffth Y Exchange Node (Independant ****) Y 613_map2.pdf Denbigh

Karthum

(assumed) Y Exchange Node (Independant ****) Y 613_map2.pdf Barrys Bay Combermere Y Exchange Node (Independant ****) Y 613_map2.pdf Barrys Bay Purdy Y Exchange Node (Independant ****) Y 613_map2.pdf Barrys Bay Maple­Leaf Y Exchange Node (Independant ****) Y 613_map2.pdf Unknown Highland Grove Unknown Exchange Node (Independant ****) Y Unknown Unknown Paudash Unknown Exchange Node (Independant ****) Y Unknown 38 County of Renfrew Development and Property Committee, ****(s) 25 ​ 26 / Appendix A [17 Nov 14] 39 EOWC Transport Fibre System Backbone Map, P­01­2009, last updated 31 Jun 11 40 Term “Exchange nodes” likely refers to Fibre to the Node (FTTN) DSL services https://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNW5UWXZEY3A0dE0/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharingTable 2 ­ CO Based Hardware 41

CO Name
Indicated
Name Type of Hardware
Indicated as
Deferral DSA on
EOWC Map Deferral Map Remarks

Petawawa Petawawa Alcatel 7750 Sites Trunk/Access Switch N 613_map2.pdf Pembroke Pembroke Alcatel 7750 / OME Photonics N 613_map2.pdf Cobden Cobden Alcatel 7750 / OME Photonics Undetermined 613_map2.pdf Calabogie Calabogie Alcatel 7750 / OME Photonics N 613_map2.pdf DSA's not detailed Lanark Lanark Alcatel 7750 Sites Trunk/Access Switch N 613_map2.pdf DSA's not detailed Lanark

McDonalds

Corner Alcatel 7750 Sites Trunk/Access Switch N 613_map2.pdf Plevna Plevna Alcatel 7750 / OME Photonics Y 613_map3.pdf Northbrook Northbrook Alcatel 7750 / OME Photonics Y 613_map3.pdf Tamworth Tamworth Alcatel 7750 Sites Trunk/Access Switch N 613_map3.pdf Tweed Tweed Alcatel 7750 / OME Photonics N 613_map3.pdf DSA's Not Detailed Madoc Madoc Alcatel 7750 / OME Photonics N 613_map3.pdf

**** **** Alcatel 7750 / OME Photonics N 613_map3.pdf

**** Lake **** Lake Alcatel 7750 / OME Photonics N 613_map2.pdf Denbigh Denbigh Alcatel 7750 / OME Photonics N 613_map2.pdf Barrys Bay Barrys Bay Alcatel 7750 / OME Photonics N 613_map2.pdf Maynooth Maynooth Alcatel 7750 / OME Photonics Undetermined 613_map2.pdf DSA's Not Detailed Apsley Apsley Alcatel 7750 Sites Trunk/Access Switch Undetermined 705_map1.pdf Sebright Sebright Alcatel 7750 Sites Trunk/Access Switch Y 705_map1.pdf 41 EOWC Transport Fibre System Backbone Map, P­01­2009, last updated 31 Jun 11 https://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qTFkxMnZRTXJDekk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qbmdfeXI2YWVOeU0/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qbmdfeXI2YWVOeU0/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharing**** **** Alcatel 7750 / OME Photonics N 705_map5.pdf

81. I would like to ask the Commission to consider the following points with regards to EORN grant funded CO upgrades in Deferral COs and/or DSAs:

a. CO upgrades may have afforded a level of subsidization to Deferral obligations if the 7750 hardware afforded FTTN VDSL2 service to Deferral DSA’s;

b. CO upgrades may have afforded a level of subsidization to Deferral communities if the CO is located within a Deferral DSA and afforded service using CO based DSL/VDSL2 (Plevna and Sebright are two known examples); and

c. CO upgrades likely afforded a level of subsidization to Deferral obligations if they enabled mobile (HSPA+/LTE) services to Deferral Towers.

82. While I beleive points a and b will be obvious in their consideration, point c is something that should be further considered as the evidence I have presented below has only recently been discovered after my oral presentation on 13 **** 16.

83. The Alcatel­Lucent 7750 suite of hardware touts the “reduced operational expense by combining wireline and wireless services” 42

84. By combining the Exchange Nodes and Alcatel­Lucent 7750 sites, the total number of points of presence that I believe ought have been identified is at least 34. This combined number alludes to the consideration that Deloitte may have been provided an incorrect and substantially lower number of sites that were afforded funding through EOWC/EORN.

85. In addition, it should be noded that CO based upgrades were to be provided as a cost against the Deferral Accounts noting the following statement from Bell:

a. “In addition, for the provision of BES, the Companies' cost of constructing one Ethernet access facility, including fibre facilities, in each of the approved communities, as well as the CPE devices at the ABSP/carrier location in the approved community are included in the access capital costs.” 43

86. The statement above, when taken into consideration that EOWC appears to have admitted to having funded CO based upgrades is highly problematic regardless of the issue if a Deferral CO is inside or outside the boundaries of an approved DSA when considered that Bell costed said CO upgrades in each Central Office of a Bell Deferral Community. 4442 ​http://enterprise.alcatel­lucent.com/?product=7750servicerouter&page=overview#​ or as ​viewed/captured on 21 Apr 16

43 Economic Study ­ Calculation of the Uneconomic Cost of the Deferral Account­Funded Broadband Expansion Program [title abridged by Mr. ****], Para 5.4.3.1 Access Captial, **** 13 [30 Mar 10] 44 County of Renfrew Development and Property Committee, ****(s) 25 ​ 26 / Appendix A [17 Nov 14] http://enterprise.alcatel-lucent.com/?product=7750servicerouter&page=overview#https://drive.google.com/file/d/0BwEjDkzP4A3qYnQyVnVMQXRaQ1E/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYnQyVnVMQXRaQ1E/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qS1lHcmp5SDJjQWM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qS1lHcmp5SDJjQWM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNW5UWXZEY3A0dE0/view?usp=sharing87. My stance on this issue is clear, and backed by strong evidence. Bell and EORN’s statements have only justified a far stronger examination of the actions of both Corporations, particularly when major discrepancies reporting are noted prior to the auditing of funds spent. I will also note, that potentially tens to hundreds of millions of taxpayer dollars and or funding allocated by the Commission may have been inappropriately used. It is also my belief, that when considered with other evidence provided in the **** ID’s I have submitted, there are very serious concerns with regards to the broadband rollout to Deferral Communities.

9366 MR. DANIELS: We think that, one, it should be technically neutral with the exception of satellite, which again, I’m happy to go into in terms of from a satellite community.

9574 You’ve said that, you know, one of the factors that you think we should consider is technological neutrality. And I take your point with respect to satellites. That’s somewhat different.

88. I will emphasize, I have outlined clear issues with regards to price plan costs, marketplace leverage, and overlapping boundaries when a previous Commissioned funded plan (Bell Deferral Accounts) endorsed technological neutrality.

89. Even after the Bell Deferral Accounts broadband rollout was reported complete, Bell has not complied with the Commission's direction, and Bell’s own statements of intent to provide broadband that “mirrors” nor “matches” DSL offerings which is summarized in Table 3 in 45 46this document.

90. One of the most striking issues is the present lack of bandwidth insurance, and unlimited options for the Bell Wireless 5 Deferral rate plan. I will note that in Bell’s offers bandwidth insurance to a maximum cap of $100 in overage charges for wireline offerings. Wireless offerings, to include the Bell Wireless 5 plan fail to offer bandwidth insurance despite Commission direction to do so.

Bell’s failure to adhere to Commission direction serve to drive up costs for Deferral wireless 47users, despite claims that Bell “matches” and “mirrors” DSL rates, and amounts to unauthorized overcharging of Deferral subscribers to the advantage of the Corporate stakeholders, and disadvantage of subscribers.

91. In addition, the present Bell Deferral Wireless plan offered is a single service offering (one rate plan). **** single single service offering was rejected by the Commission for Deferral rate plans.

48 49

45 ​Request to Commission Review, Rescind and **** DSL Technology Directive in CRTC 2010­637, Para 8 [08 Oct 10]

46 Bell Oral Comments, CRTC 2015­134 Transcripts, Para 9580 [19 Apr 16] 47 CRTC 2010­805, Para(s) 8 ­ 10 [29 Oct 10]

48 CRTC 2010­637, Para 29 [31 Aug 10]
49 CRTC 2010­805, Para 8 [29 Oct 10]

https://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qYzc2M1BTZ0lTQTQ/view?usp=sharinghttp://www.crtc.gc.ca/eng/transcripts/2016/tt0419.htm

https://drive.google.com/file/d/0BwEjDkzP4A3qWm5oTGpxRS02X2s/view?usp=sharinghttp://www.crtc.gc.ca/eng/archive/2010/2010-637.htm

https://drive.google.com/file/d/0BwEjDkzP4A3qWm5oTGpxRS02X2s/view?usp=sharing92. The goal of any Commission fund should be to provide broadband in line with what those in Urban areas receive keeping in line with the objectives of the Telecommunications Act. As noted by the Commission, the vast majority of Canadians receive broadband thru wireline. Those 50under wireless plans are afforded a disadvantageous service in terms of cost, cost per unit of usage, quality, and offerings as per Table 3. **** disadvantage is emphasized when the same conglomerate company that fails to afford wireline services, yet charges several time more for wireless. **** pricing indicates serious problems with the market forces in play.

93. I will note that the Bell Deferral Accounts Wireless rollout serves as an example being the most cost rollout as outlined in CRTC 2010­637. The insight gained from the examination of this 51deployment is that wireline rollouts are cheaper in rural communities for incumbent companies.

50 CRTC 2015­134, Para 6 [09 Apr 15]
51 CRTC 2010­637, Para 36 [31 Aug 10]

https://drive.google.com/file/d/0BwEjDkzP4A3qSnJHU0YwVXR6S3M/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qR2c5RWtUSUpYV2c/view?usp=sharing94. I ask the Commission to consider why it should allow a company the choice under the premise of technological neutrality, without price plan and service parity as compared to urban customers noting the table below:

Table 3 ­ Bell DSL, Bell Wireless & Xplornet Satellite Rate Plan Comparison ­ Assorted Usages and the Effect of Failure to **** $100 Bandwidth Insurance (as afforded to Bell DSL customers) 52

**** Highlights​ are present offerings as of 18 May 16 ­ ​Red highlights​ are older plans that users may be forced to remain on due to multi year contracts ­ likely require contract hardware buyout which would be in effect an additional plan upgrade cost Plan

Base Plan
Monthly
Cost
Bandwidth
usage
included in
base monthly
plan (GB)
Overage
Cost
(GB)
Usage
(GB)
Monthly
Cost
Usage
(GB)
Monthly
Cost
Usage
(GB)
Monthly
Cost

Fibe 5 DSL​ 53 $64.95 68 $3.00 125 $164.95 159 $164.95 200 $164.95 Fibe 10/1 (best effort DSL)​ 54 $64.95 125 $3.00 125 $64.95 159 $164.95 200 $164.95 Bell Wireless 5 (HSPA+/LTE)​ 55 $63.95 100 $4.00 125 $163.95 159 $299.95 200 $463.95 Bell Mobile Internet Plus

(HSPA+/LTE) (Best Effort

****)​ 56 $145.00 100 $5.00 125 $270.00 159 $440.00 200 $645.00 Bell Turbo Hub 57 $90.00 20 $10.00 125 $1,140.00 159 $1,480.00 200 $1,890.00 Bell Fixed Wireless (5/1)

(HSPA+/LTE)​ 58 59 $65.00 10 $10.00 125 $1,215.00 159 $1,555.00 200 $1,965.00 Xplornet Satellite​ 60 $94.00 40 $2.00 125 $264.00 159 $332.00 200 $414.00 95. The consideration of technological neutrality should be further amplified when the aspect of leverageable multi use networks are considered such as LTE/HSPA+, fibre backbone, and CO upgrades. The total effects and gained leverage on the marketplace for both wireline and wireless 52 Unlimited Offerings for Wireline customers are set aside in this tabled consideration of rate plans 53 File DM#2597343, submitted as part of CRTC 2015­134, current as of 05 May 16 54 Bell Rate Plan Screenshot, [www.bell.ca] [04 May 16]

55 Bell Deferral Account Rate Plan ­ Single Service Offering ​[unadvertised ­ some elements detailed in CRTC **** ID 701360]

56 Bell Mobile Internet Plus, [www.bell.ca] [18 May 16]

57 Bell Turbo Hub, Former HSPA+/LTE Rate Plan [many subscribers likely remain on said rate plan up until recently due to long term 2 year contracts]

58 Bell Fixed Wireless, [www.bell.ca] [18 May 16]
59 Available only in select areas

60 Xplornet Communications Inc. ABRIDGED Response to Interrogatory, Information Requested by Affordable Access Coalition, Pages 3 ­ 5 [PDF document pages 26 ­28] [21 Sept 15] https://drive.google.com/file/d/0BwEjDkzP4A3qQnVTTVgwanN2WFU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qMmN3ODhvU0RsVTg/view?usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qdXRHdGc4S2p5SWc&usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qdXRHdGc4S2p5SWc&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qVWNWNU5jeHZHblU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qWnp3OGZ6Y0xPWm8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qZVJSZjRyZ1h4a00/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qZVJSZjRyZ1h4a00/view?usp=sharingdeployments can be staggering when mobile upgrades are included, to include the ability to tie into grant funded backbone and CO upgrades to afford both wireline and wireless services.

96. For an example of this, I can refer to Bell Deferral Pembroke DSA 403­0. I would like to point the Commission to Lat/Long ​45.7820656,­77.2294837​ and the pictured backbone wireline and the tower(s) to the right. A grant funded EORN backbone was provided to to afford ​FTTN services​, and concurrently, f​ibre lines we also laid/tied into​ to provide wireless services using Deferral Account funds to serve the same community at the junction noted above.

97. Curiously, the tower(s) served by the fibre have also been brought up as part of CRTC **** ID 722533, and will be further elaborated on later in this document making this rollout the potential of a triple subsidy example regarding the granting of funds involving the Laurentian Valley Petawawa Broadband Initiative, EOWC/EORN, and Bell Deferral funds.

9582 But the problem is if we start preferring technologies then we’re going to end up with a much higher cost as we design our network. You’re going to give advantage to wireless carriers, which maybe I shouldn’t be complaining about but, you know, you’re ­­ if the goal, and we think the goal should be to bring broadband of 5 and 1 to all Canadian households, then we want to do that effectively and the most efficiently. And if you start having parameters where you prefer one technology to another it’s going to take the cost up and take players out of the market and distort the market, which we don’t think is the right way to go.

98. As Bell is the dominant provider in in this country, I find it curious why the Company states that taking smaller players out of the market can distort the market? How would Bell be negatively affected by the elimination of smaller players? Why does Bell now value its competition considering that it wished to eliminate wholesale competition on its fibre to the home offerings through a **** to Council that has since been rejected?

99. In addition, I predict Bell likely will not be complaining about the supposed advantage given to Bell Mobility for wireless rollouts considering the rates plan comparisons detailed in Table 3.

100. However, what I find interesting is the statement that there would be an advantage given to wireless carriers in terms of cost for roll­out to include the considerations for both a Bell wireless rollout, or a competitor's wireless network rollouts? For the Bell company, Bell Deferral Accounts rollout was cost estimated to be a far higher cost than a wireline solution as stated in CRTC 2010­637. 61

101. Of final consideration, is the rate plans detailed in Table 3. If wireless is considerably cheaper to deploy, then provide justification why Bell wireless plans are considerably more in cost and usage with lessened offerings? Is it the lack of competition within the broadband markets serviced by wireless leading to higher rates and lessoned service offerings? Are market 61 CRTC 2010­637, Para 36 [31 Aug 10]

https://www.google.ca/maps/@45.7820656,-77.2294837,3a,75y,249.13h,99.14t/data=!3m6!1e1!3m4!1s87S3Pg69JBQKwmU7UekOLw!2e0!7i13312!8i6656?hl=enhttps://drive.google.com/file/d/0BwEjDkzP4A3qZDhPdVVGc1Jpbnc/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qZDhPdVVGc1Jpbnc/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNXJIemtjcGJfWUk/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qR2c5RWtUSUpYV2c/view?usp=sharingforces working in driving down plan prices when considering the supposed lessened investment wireless requires?

9579 And our direct experience in this is actually the deferral account situation where we proposed and built out for the deferral account broadband to 108 communities in Ontario and Quebec to bring them broadband at speeds of 5 and 1. But we spent, as you know, over $300 million on this. And that wasn’t just about building towers to places that didn’t have towers; there was some of that.

9580 But it was also building more towers to be able to handle the greater volumes of demand to building more robust in terms of backbone networks to handle the greater use that was expected to have because ultimately the product we launch is one that matched terrestrial rates so we were expecting greater use.

102. I have outlined a comparison of DSL rates, and Bell Wireless 5 (the only Deferral Rate Plan) rates as per Table 3 in this document. Deferral Wireless rates (Bell Wireless 5) do not match terrestrial rates in terms of rate plans offered, overage charges, contract lengths and plan upgrade costs.

103. Why did Bell see the need to deploy grant funded DSL to many of the Deferral communities in addition to wireless noting the issues I have presented in the above mentioned CRTC **** ID’s?

104. Further to this, is is the Bell Deferral Accounts wireless HPSA+ rollout considered terrestrial or non­terrestrial by Bell?

9579 And our direct experience in this is actually the deferral account situation where we proposed and built out for the deferral account broadband to 108 communities in Ontario and Quebec to bring them broadband at speeds of 5 and 1. ​But we spent, as you know, over $300 million on this.​ And that wasn’t just about building towers to places that didn’t have towers; there was some of that.

105. I would like to reference CRTC **** ID 701360, and Bell’s claim that they spent over $300 million. I fail to understand why Bell has not claimed it spent $463.6 million dollars as per CRTC 2010­637, Para 36 considering this information is in the public domain?

106. I will emphasize, that said cost estimate’s supposed accuracy caused the Commission to adjust the Bell Deferral Accounts allocation for broadband downwards to $306.3 million. This 62adjustment was based on the expectation that Bell was going to spend at minimum its cost estimate of $463.6 million and equals a difference of $157.3 million.

62 CRTC 2010­637, Para(s) 41 ­ 42 [31 Aug 10]

https://drive.google.com/file/d/0BwEjDkzP4A3qR2c5RWtUSUpYV2c/view?usp=sharing107. If Bell’s statement is true, and the Bell Company spent only the Commission allocated amount, this would be a serious matter in that the Commission found it appropriate to not conduct a detailed cost analysis based on the above mentioned difference in cost which served to act as a buffer in the requirement for auditing. 63

Q. In response to Bell(Vaxination)14Aug15­5 Bell states:

There are areas, like the Greenbelt close to Toronto, where our cost to build per home does not presently justify the investment in high­speed Internet facilities. The homes in such areas are located beyond the service area covered by our high­speed network and deploying additional fibre and electronics to serve them to date has not been economically viable due to the very large distance between homes which often averages one kilometre or more.

Explain fully whether it is Bell’s position that these customers’ need for broadband at the Commission’s existing target levels can be met by other providers using alternate technologies. If not, explain fully how, under Bell’s proposal, the needs of these customers will ever be met.

A. While serving these areas has not been economically viable for us using our high­speed network, these areas represent important opportunities for other providers using alternate technologies. For example, the Greenbelt close to Toronto is an important serving area for Xplornet. Xplornet has stated that it has more customers in the Greenbelt close to Toronto than it has in any other region in Canada.1 Furthermore, Xplornet has publicly announced that it intends to cover 100% of Canadian residences and businesses with speeds of 25 Mbps download by 2017. Other providers may also choose to serve these areas using fixed wireless technology. Accordingly, in our view alternate providers will be able to serve the areas in question with broadband that exceeds the Commission’s existing target levels.

108. I would like to state the following objective from the Telecommunications Act:

a. “to render reliable and affordable telecommunications services of high quality accessible to Canadians in both urban and rural areas in all regions of Canada;” 64109. I would also like to note, that this is not new territory for Bell. Bell likely serves said territory with landline voice, and Bell wireless offerings for broadband as per Table 3. There are serious rate plan price discrepancies in pricing amounting to considerable mark­ups for suggested urban usages amounting to over over $1000 dollars monthly in some comparisons. I believe the prices stated in Table 3 of this document and my submission regarding the Commission’s legal authority detailed in the footnote reference will further substantiate my statements. 65110. In the statement above, it appears that Bell is endorsing alternate providers for communities and commenting on their provision of service to include an endorsement of Xplornet Satellite 63 CRTC 2010­637, Para 42 [31 Aug 10]

64 Telecommunications Act, Para 7, Subpara (b)

65 CRTC 2015​134 ​ Response to questions regarding the Commission’s legal authority, **** 24 ­ 56 [04 May 15]

http://www.crtc.gc.ca/eng/archive/2010/2010-637.htm

https://drive.google.com/file/d/0BwEjDkzP4A3qUDVIYXpWVWRNLVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qVUwzcmV6a2gxdWM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qVUwzcmV6a2gxdWM/view?usp=sharingtechnology as an alternate provider of service in areas that Bell already serves. (noting only Xplornet satellite will likely gain 100% coverage of Canada by 2017) 111. I would also ask the Commissioner to consider a factor in Bell’s disinterest in affording service to households that may be on the cusp or edge of service, near urban centres within Bell’s present operating territory. **** factor may be called implicit collusion. 66112. Implicit is defined as lacking a formal agreement for the purposes of this description.

113. Collusion ​is an agreement between two or more parties, sometimes illegal and therefore secretive, to limit open competition by deceiving, misleading, or defrauding others of their legal rights, or to obtain an objective forbidden by law typically by defrauding or gaining an unfair market advantage for the purposes of this description.

114. **** market advantage in this particular case, would be the act of colluding to divide a market into serving territories.

115. Bell’s own statements allude to serious concerns of potential unlawful activity with regards to market forces in the provision of telecommunications services. The act of dividing markets to not compete with each other is illegal under the Competition Act as noted by the following:

45​ ​(1)​ ​Every person commits an offence who, with a competitor of that person with respect to a product, conspires, agrees or arranges

(a)​ ​to fix, maintain, increase or control the price for the supply of the product; (b)​ to allocate sales, territories, customers or markets for the production or supply of the product; or

(c)​ to fix, maintain, control, prevent, lessen or eliminate the production or supply of the product.

Marginal note:Penalty

(2)​ Every person who commits an offence under subsection (1) is guilty of an indictable offence and liable on conviction to imprisonment for a term not exceeding 14 years or to a fine not exceeding $25 million, or to both.

Marginal note:Evidence of conspiracy, agreement or arrangement (3)​ In a prosecution under subsection (1), the court may infer the existence of a conspiracy, agreement or arrangement from circumstantial evidence, with or without direct evidence of communication between or among the alleged parties to it, but, for greater certainty, the conspiracy, agreement or arrangement must be proved beyond a reasonable doubt.

66 ​http://www.amosweb.com/cgi­bin/awb_nav.pl?s=wpd&c=dsp&k=implicit+collusion http://www.amosweb.com/cgi-bin/awb_nav.pl?s=wpd&c=dsp&k=implicit+collusion116. I would argue that Bell may have admitted to a level of collusion based on the company’s written statement provided to the Commission. Noting that it takes only one party to initially conspire, said collusion occurred in the action of failing to deploy its own technologies (prevent), and also stating that the company would chose to allocate territories to a competitor. **** statement could potentially be considered implicit collusion with other service providers, by ensuring that subscribers are afforded the most disadvantageous, costly and least desirable broadband technology (referring to satellite and other wireless technologies) through the allocation of territory and failure to compete.

117. In addition, said collusion could be occurring between subsidiary and parent companies in the case of the Corporations of Bell wireline and Bell Mobility offering the most disadvantageous technologies in terms of pricing, noting the difference in costs between Bell Wireless and Bell wireline detailed in Table 3 of this document. **** difference in costs may also emphasize the aspect of fixing, maintaining, controlling, preventing, lessening or eliminating the supply of a product by non deployment or selective deployment of the most expensive technologies to a subscriber within a given area.

118. I will note, that if my arguments are deemed to be plausible by the Commission, this would allude and lend credence to the Commission’s consideration that market forces may not be working in some parts of the country for the provision of reliable and affordable telecommunications services to include the consideration of technological neutrality.

Bell Canada/Bell Mobility Inc./CVQ/DMTS/KMTS/ Response to Request NorthernTel, Limited Partnership/Northwestel Inc./ Bell et al(CRTC)2Nov15­7 TNC 2015­134 Ontera/Télébec, Limited Partnership Abridged [1 Dec 15]

Bells Deferral Account program delivered HSPA/LTE fixed wireless service to 108 unserved and underserved communities in Ontario and Quebec. Similarly ​HSPA/LTE fixed wireless​ service is offered to OMAFRA communities, i.e. Simcoe, ****, Dufferin, Middlesex, ​Laurentian​, **** Glengarry and ****.

119. I ask the Commission to consider that “Laurentian” is likely referring to the Laurentian Valley Petawawa Broadband Initiative (LVPBI), which received funding from the OMAFRA.

The LVPI was a municipally directed broadband program, funded through the OMAFRA that afforded both wireline and wireless services through Bell. Of note, fixed wireless at rates even closely comparable to DSL are not presently not available to all Bell Deferral Communities. 67120. I will note, that no special rate plans were afforded to OMAFRA funded communities for Bell Wireless internet. As per Table 3, said rates would be given at Bell Wireless rates other than Bell 67 Bell Fixed Wireless screen capture, Pages 1 ­3 [www.bell.ca] [18 May 16] https://drive.google.com/file/d/0BwEjDkzP4A3qT0VkMEF3dWtiNzg/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qT0VkMEF3dWtiNzg/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qT0VkMEF3dWtiNzg/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qWnp3OGZ6Y0xPWm8/view?usp=sharingWireless 5 if said communities were outside of Bell Deferral DSA’s. Taxpayer grant funds 68were effectively used to afford the most disadvantageous, and costly broadband technology in terms of deployment to subscribers.

121. Further to this, ​CRTC **** ID 722533​ [16 Oct 15], clearly outlines three towers in two discernible locations by Lat/Long, initially detailed to be Inukshuk Wireless Inc towers through Bell. However, inside said case ID, I note that Bell’s participation in Inukshuk Wireless Inc is discontinued along with its participation in the Bell Sympatico Unplugged Service less than a year after the conclusion of the LVPBI rollout. Inside this document, I further asked the Commission to follow up on the wireless leverage that Bell has gained through the provincially/municipally funded LVPBI as part of the Deferral Accounts program.

122. Bell’s statement above seems to indicate that the leverage gained was far more substantial than originally thought, particularly when HSPA+ was the authorized technology of the Bell Deferral Accounts program.

123. Noting that to my knowledge there was only one Laurentian broadband program within my community, Bell’s statement adds to the evidence that grant funding provided wireless HSPA/LTE services in Deferral DSA’s detailed such as Pembroke 780­1, Pembroke 403­0, and Pembroke 111­0 as per the Lat/Long coordinates stated within the footnoted document. I have 69prepared Attachments B and C to this document to further describe the allegations I have outlined.

124. I ask the Commission to consider Bell’s statements regarding EORN and the aspect of “truing up”, and “cutting cheques” detailed within this document. Did Bell cut any cheques back to the LVPBI program, my municipality, and/or the Ontario government?

68 Referring to Turbo Hub Rate Plans, and recently offered Mobile Internet Plus Rate Plan 69 CRTC **** ID 722533, Whole Document [16 Oct 15]

https://drive.google.com/folderview?id=0BwEjDkzP4A3qT2ROODdBLWFjRDQ&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qVlFtSTRlSXZwMUU/view?usp=sharing125. I believe that a pattern of serious funding issues surrounding the Bell Deferral Accounts broadband rollout has occurred when all of my **** ID’s have been considered. I ask the Commission to consider the following OMAFRA Municipalities/Communities detailed above by Bell, and the Deferral CO’s located within them as per Table 4:

Table 4
Municipality/Community Bell Deferral Central Offices
Simcoe Creemore, Bluewater ****, Sebright 70 71
**** Sarnia Michigan
Dufferin Dundalk, Flesherton, Feversham 72 73 74
Middlesex County Ailsa ****, Lucan
**** County ****, Wiarton

Bell Canada/Bell Mobility Inc./ Response to Request Câblevision du Nord du Québec inc./DMTS/KMTS/ The Companies(CRTC)7May15­9 TNC 2015­134 NorthernTel, Limited Partnership/Northwestel Inc./ Abridged Ontera/Télébec, Société en commandite, **** 3 [14 Jul 15] We understand that Industry Canada excluded mobile wireless and satellite coverage with the exception, at least in our case, of our Deferral Account fixed wireless footprint (i.e., locations in which our rates are set to match wireline DSL rates).

CRTC 2015­134, Review of Basic Telecommunications Services, Intervention of Bell Canada and its Affiliates, **** 90, Footnote 110 [14 Jul 15]

Even when using a fixed wireless solution, the Commission did not regulate the retail rate but instead required Bell to match its urban rates. At paragraph 10 of Decision 2010­805, the Commission summarized Bell Canada’s proposal in this regard as “Bell Canada indicated that its HSPA+ wireless technology proposal (the revised proposal) would address the requirements identified by the Commission in Telecom Decision 2010­637, such that the approved communities in Ontario and Quebec would have access to a broadband service that was comparable, or in some cases superior, to what is available in urban areas.” An associated footnote further explained “the features available with 70 CRTC **** ID 701360, Mr. **** Adams, Para 21, [submitted 15 Sept 15] 71 The Packet and Times, **** Minassian, **** 2 [07 Oct 11]

72 Dundalk located in Grey County ­ note that wireless/municipal boundaries overlap, and not all tower placements are within a Deferral DSA

73 Flesherton located in Grey County ­ note that wireless/municipal boundaries overlap, and not all tower placements are within a Deferral DSA

74 Feversham located in Grey County ­ note that wireless/municipal boundaries overlap, and not all tower placements are within a Deferral DSA

https://drive.google.com/file/d/0BwEjDkzP4A3qdzNoZ3Z3OGMzbGs/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdzNoZ3Z3OGMzbGs/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdzNoZ3Z3OGMzbGs/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qaU4wTGdVY2x2S1E/view?usp=sharinghttps://drive.google.com/file/d/1eU0oQuTADGYOduuRSG9gFfJa3AUeuHBHXAs3ljgQce0n9xpw7VeFoAlqs-KRFqr1VNb5oO6dgq5UdTzw/view?usp=sharingthe revised proposal include (i) various retail service options (i.e. speeds and usage caps), (ii) monthly usage allowances greater than 2 GBs, and (iii) an insurance option providing an extra 40 GBs of usage for $5 per month.” The Commission approved this approach at paragraph 20 of that same decision stating “the Commission considers that Bell Canada’s commitment to maintain comparability as urban broadband service improves, as well as to make an appropriate wholesale service available, will ensure that consumers in the approved communities have access to high­quality broadband services over the long­term.”

126. I would like to request that the Commission refer to the rates at various usages detailed in Table 3.

127. I would also like to ask the Commission to consider if Bell offers the following as part of its Deferral Accounts Plan (referring to the single service offering of Bell Wireless 5):

a. Assorted rate plans and speeds;
b. Availability of wireless unlimited;

c. Ability to upgrade plans at a comparable upgrade costs to DSL; d. Matching of rate plans between landline and wireless broadband; and e. Availability of wireless usage insurance and usage rate cap (presently not available). 75128. In addition, the Commission should consider the points brought up in CRTC **** ID 701360 with regards to Bell’s actions in leveraging their Deferral HSPA+ network. What makes Bell’s 76HSPA+ network different that the Rogers HSPA+ network that it deserves special consideration by Industry Canada? This consideration is striking when considered that Bell has likely never offered fixed wireless, nor an external antenna to Bell Deferral DSA’s using the Bell Wireless 5 plan. References on the antenna issue are detailed in CRTC **** ID 701360, and later in this document.

CRTC 2015­134, Review of Basic Telecommunications Services, Intervention of Bell Canada and its Affiliates, Para 180, **** 84 [14 Jul 15]

“To be clear, as long as the solution meets service or pricing requirements associated with it, a TSP should be eligible to bid for that solution. This approach is similar to what the Commission decided in the case of the broadband deferral account builds. Ultimately, the Commission allowed us to utilize a fixed wireless solution instead of a wireline DSL solution, provided that we ensured our retail offer matched the quality and rates of our DSL offers”

Bell Canada/Bell Mobility Inc./ Response to Request Câblevision du Nord du Québec 75 CRTC 2010­637, Para 31 [31 Aug 10]

76 CRTC **** ID 701360, Para(s) 40 ­ 47 [15 Sept 15]

https://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qbWNrNlRicV9VenM/view?usp=sharinghttp://www.crtc.gc.ca/eng/archive/2010/2010-637.htm

https://drive.google.com/file/d/0BwEjDkzP4A3qaU4wTGdVY2x2S1E/view?usp=sharinginc./DMTS/KMTS/ The Companies(CRTC)7May15­11 TNC 2015­134 NorthernTel, Limited Partnership/Northwestel Inc./ Abridged Ontera/Télébec, Société en commandite, **** 5 [14 Jul 15] For Bell Mobility, ****­Term Evolution (LTE) is generally being rolled­out for broadband. Fixed wireless has been deployed to approximately 108 communities in the context of the deferral account roll­out.

129. Fixed wireless typically details an external antenna be used and mounted in a fixed position typically on a subscriber's residence or property. How many subscribers, at the rate plans set for the Bell Wireless 5 plan (the single service offering available to Bell Deferral wireless subscribers), have had professional installations with an external antenna noting that said 77 78service is not offered at Bell Wireless 5 rate plans? 79 80CRTC 2015­134, Review of Basic Telecommunications Services, Intervention of Bell Canada and its Affiliates, Para 61, **** 36 [14 Jul 15]

“the subsidy should only be available in circumstances where the Commission has determined that no government funding is or will become available to fund the deployment of broadband in the target community;”

130. I found Bell’s proposal to be worthy of mention considering what has been highlighted in CRTC **** ID’s 701360, 722533 and 728559 involving the allegation of grant funds used in Bell Deferral DSA’s amounting to what will likely be considered as a double, and in same cases triple subsidy. 81 82

CRTC 2015­134, Review of Basic Telecommunications Services, Intervention of Bell Canada and its Affiliates, Para 199, **** 90 [14 Jul 15]

Retail rates should not be regulated. We note that in the case of the deferral account, the Commission did not set maximum retail rates nor should such rates be set in the case of areas which receive broadband subsidy funds. The service would have to be defined to include a download speed (i.e., 5 Mbps) as well as some level of usage that is appropriate for the speed chosen.

77 ​CRTC 2010­637, Para 32 [31 Aug 10]
78 ​CRTC 2010­805, Para 9 & 10 [29 Oct 10]

79 ​Telecom Decision 2010­637, Follow up to CRTC 2008­1, Para 16 [31 Jul 12] 80 Telecom Decision 2010­637, Follow up to CRTC 2008­1, Para(s) 37 ­ 39 [15 Jan 14] 81https://drive.google.com/folderview?id=0BwEjDkzP4A3qfmJ0bkMwbEpvYmViWW9kdEdBakJQbVN4XzdRVjB4TGNuOEIyYVZLWWZHRUk&usp=sharing

82 ​https://drive.google.com/file/d/0BwEjDkzP4A3qekUyUE1oVmFQdWc/view?usp=sharing https://drive.google.com/file/d/0BwEjDkzP4A3qbWNrNlRicV9VenM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qbWNrNlRicV9VenM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qR2c5RWtUSUpYV2c/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qWm5oTGpxRS02X2s/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNGtaMFpxbjVqZms/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qajlTaDg3X1c4d3M/view?usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qfmJ0bkMwbEpvYmViWW9kdEdBakJQbVN4XzdRVjB4TGNuOEIyYVZLWWZHRUk&usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qfmJ0bkMwbEpvYmViWW9kdEdBakJQbVN4XzdRVjB4TGNuOEIyYVZLWWZHRUk&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qekUyUE1oVmFQdWc/view?usp=sharing131. I ask the Commission to consider that with the consideration of technological neutrality, comes rate and price plan parity in line with urban subscribers. Table 3 of this document amplifies the reasoning for adopting price plan parity to avoid the deployment of disadvantageous technologies that afford a company marketplace leverage.

132. Without said parity, the service offering afforded to communities not afforded the same technology as urban centres becomes a disadvantageous and discriminatory service offering, and in some cases said disadvantage is afforded by the same company providing a wireline service.

This disadvantage would be for example a service provider offering by a wireline voice or wireline TV, and then elects to afford broadband services through wireless with a pricing plan that is disadvantageous towards its subscriber as compared to wireline offerings in both service provision and overall price plan at assorted usages.

CRTC 2015­134, Review of Basic Telecommunications Services, Intervention of Bell Canada and its Affiliates, Para 201, **** 91 [14 Jul 15]

In order to ensure that the winning bidder delivers the service as described, the winning ISP should be required to provide annual updates similar to how Northwestel reports on its Modernization Plan or how ILECs have reported on their deferral account broadband builds.

133. I agree that Bell should continue to provide quarterly reports on the price plan and parity of its Deferral Wireless communities, and how it will continue to be maintained. This reporting should include mandatory reporting of the use of grant funds to provide services in any part of a Deferral CO, rather than DSA of a Deferral Community, considering that the Uneconomic Study is detailed until 2024, and Bell has promised to maintain parity with Urban rates and speeds 83using wireless. 84

134. In addition, I am hopeful the Commission considers aggressively monitoring the issues of broadband grants in a manner I detail in CRTC **** ID 701360. 85Bell Canada and its Affiliates, TNC 2015­134 – Further Intervention, Para 109, **** 37 [1 Feb 16] We recommend that the Commission also exclude mobile wireless services from consideration in a similar manner. However, any carrier that is willing to bid and live up to the terms of service associated with the ultimate proposal, should be allowed to bid using wireless (fixed or mobile) infrastructure.

83 Bell Deferral Accounts Uneconomic Study [30 Mar 10]
84 CRTC 2010­805, Para 10 [29 Oct 10]

85 CRTC **** ID 701360, Mr. **** Adams, Para(s) 70 ­ 72 [18 May 15] https://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qQ2tMaWMyNGxhbVU/view?usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qOC1UeVhQSXg2azQ&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qWm5oTGpxRS02X2s/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qeWNqcUZZNGl5TlU/view?usp=sharing135. I ask the Commission to consider that wireless was detailed to be the most cost proposal as part of the Deferral Accounts program at a margin of $57.3 million more (12% more) than a DSL deployment. This is noting that there is no public disclosure of how many towers the Bell 86Deferral Accounts program paid for, and the consideration that HSPA+ was already present in 87the vast majority of Deferral Communities. 88 89

136. In addition, I ask that the Commission consider what happens when dual use wireless infrastructure and/or towers at the most cost (referral to the Deferral Accounts Program) is afforded to a community, and then a conglomerate company then affords the lessor cost wireline to a community thru any funding means?

137. Noting the overlapping boundaries of wireless, which often overlap rate plan boundaries, the result is that a Corporation receives a subsidization of the most cost equipment (referring to wireless), and then at its own cost or thru other means affords wireline services by leveraging the grant funded backbone that was likely provided to serve the wireless towers. **** subsidization serves to supplement costs of companies such as Bell by approximately 12% noting the difference in Bell Deferral Accounts costs detailed in CRTC 2010­637, Para 36. 90138. In effect, Bell’s suggestion allows the company a wider capital costs gain on the use of funds granted, to afford the most expensive rate plans to the most profitable outcomes for the Corporation as detailed in Table 3.

139. The further consideration for the Commission, is what happens to said wireless network equipment and/or towers, particularly if it is designed as a dual use HSPA+/LTE network that also provides mobile services and includes a funded fibre backbone to the tower? I am referring to the leverage effects of merged technology upgrades of conglomerate companies.

140. When above stated consideration includes Table 3, in that all wireline offerings are of considerably lessened cost and far more advantageous in offerings, subscribers will naturally choose wireline whenever offered, particularly considering the higher quality service that wireline affords.

141. A conglomerate company providing both wireline and wireless can then simply leverage the backbone provided to provide wireline internet thru any means, and free up spectrum for more selective use by disadvantaging some subscribers, and concurrently dedicating more the spectrum to more profitable mobile use.

86 ​CRTC 2010­637, Para 36 [31 Aug 10]

87 Bell Quarterly Reporting, Bell Deferral Accounts Rollout [whole submission and specifically Note 1 of Attached spreadsheet] [15 Jul 14]

88 Letter signed by Mirko Bibic, Para 2 [30 Mar 10]
89 ​CRTC 2010­805, Para 22 [29 Oct 10]

90 Difference between Wireless and Wireline deployment amounted to 12% more costly for a wireless deployment.

https://drive.google.com/file/d/0BwEjDkzP4A3qR2c5RWtUSUpYV2c/view?usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qd1Z6OXl6amJ6dmM&usp=sharinghttps://drive.google.com/folderview?id=0BwEjDkzP4A3qd1Z6OXl6amJ6dmM&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdk10cWVCUFBOMm8/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qWm5oTGpxRS02X2s/view?usp=sharing142. In effect, a minimum 12% gain on capital investment is gained the day the dual use network is deployed due to the increased cost of wireless deployments. This gain also includes the consideration that as of this time, there is no 3rd party wholesale access afforded to subscribers.

143. The fibre backbone, and/or CO upgrades that may be afforded in addition to the wireless towers are likely all leverageable technologies to tie into for use on FTTN DSL deployments, and potentially FTTH.

144. Bell may wish to fully disclose to the Commission what Deferral communities it has thus far afforded FTTH. I can state with some confidence that the Bell Deferral communities of **** Erie, ****, and Stevensville may have been afforded FTTH. It is worthy of further study as to what happens to Bell’s HSPA+ (and potentially LTE ­ noting that Bell likely deployed LTE using Deferral Account Funds) network after both FTTH and FTTN deployments occur in a Deferral community. Noting that Deferral funds also included costing for backbone and CO upgrades, there is the potential that in said Deferral communities, Deferral funding equipment was leveraged for FTTH. 91

91 CRTC **** ID 701360, Para(s) 76 ­ 78 [18 May 15]

https://drive.google.com/file/d/0BwEjDkzP4A3qeWNqcUZZNGl5TlU/view?usp=sharingA COMPARISON OF THE WHOLE CONCEPT PRICE PLAN TECHNOLOGICAL NEUTRALITY CURRENTLY PROVIDED BY BELL ­ BROADCAST OFFERINGS

145. I think it is is important for the Commission to consider the aspect of technological neutrality and price plan parity in terms of conglomerate companies that leverage both wireline and wireless offerings. Unfortunately for individual subscribers, differing rate plans are afforded in a disadvantageous manner using grant and/or Corporate funds as described throughout this document and notably in Table 3.

146. One marketplace that does offer a comparable and non­disadvantageous price plan offerings is the broadcast TV market: Bell’s Satellite offerings vs Bell’s Fibe TV (Fibre To The **** 92 93TV). In addition to the footnote references, I have included a screen capture within the attachment document to this submission.

147. In this particular market comparison, Bell affords rate plan parity thru wireless and wireline broadcast means to include the consideration that the Bell FTTH TV market is a very recent offering, and Bell wireline TV (FTTH) is a far less mature of a market than both wireless and wireline broadband.

148. As per the attachments, said said broadcast TV parity extends to exacting packages, rate plans, and even installation fees. The price parity extends down to dollars and cents in comparison.

149. To summarize, Bell market areas are delivered services using wireline, and one using wireless technologies at price parity with no disadvantage due to the technology offered.

150. In the comparison of broadcast TV offerings, Bell should be offered praise for fully embracing the whole concept principle of technological neutrality. However, this hearing is not about assessing broadcast TV, nor does Bell deserve any form of praise for its incomplete embracement of broadband technological neutrality.

151. I ask the Commission to consider the submissions of Bell broadcast price plan offerings through wireline and wireless to be highly relevant in its examination of rate plan comparisons of broadband technologies with regards to conglomerate companies and the selective and/or disadvantageous implementation of broadband technologies. In terms of broadcast television, there appears to be little disadvantage to selecting wireline or wireless in terms of rate plans and costs to the subscriber.

152. This is particularly noting the mature marketplace of wireline and wireless broadband as compared to Fibe TV (wireline), and the disadvantageous prices offered to Bell Wireless broadband subscribers.

92 Bell Satellite TV Rate Plans [www.bell.ca] [as viewed 20 May 16] 93 Bell Fibe TV (FTTH) Rate Plans [www.bell.ca] [as viewed 20 May 16] https://drive.google.com/file/d/0BwEjDkzP4A3qYXB4NFRjZXkxZ1E/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qUmlBejdvNzJhTU0/view?usp=sharing153. To summarize, Bell is overcharging broadband subscribers as described in Table 3, while only embracing the aspects of broadband technological neutrality that it chooses to.

Conclusion

154. I would like to comment in my conclusion on my suggestions for the national broadband strategy as requested by the Commission. In short, it is my belief that there isn’t necessarily one size fits all for the whole nation. I prefer to comment on the strategy to alleviate issues with regards to those on the cusp of service near more populated areas, as they are least likely to be afforded grant funds as part of broadband rollouts. In my particular case, I am 8.3 KM line distance from the Bell Central Office, noting that many areas much farther from my household are well served with wireline internet with FTTN technologies using either grant or Corporate funds.

155. I believe communities should be identified by their incumbent service providers, and if said incumbent already services a majority of the the community with wireline, then any wireless offerings by the same provider should be service plan matched in terms of price and service offerings to include broadband usage insurance and unlimited offerings.

156. Subscribers within a community should not be disadvantaged by the selective implementation of technologies under the guise of technological neutrality. Companies should be forced to embrace the whole concept of technological neutrality. Without price and rate plan parity, there cannot be technological neutrality.

157. In addition, the actual network investment should be considered. In many circumstances, grant funds have been used to afford disadvantageous services. Corporations should be mandated that the use of any grant funds to afford broadband services equals the provision of rate plans at urban rates.

158. The above stated action will go a long way to correct many issues suffered by those on the cusp of wireline service. Those are the most disadvantaged, in that said communities are typically ineligible for grant funds, yet they are often afforded the highest costs services. In my household, I have not been afforded wireline internet, and I am forced to use a disadvantageous Bell Wireless rate plan as my only alternative offering.

159. In addition, I ask the Commission to consider ordering incumbent wireless providers who provide service for the purposes of residential broadband to provide access to wholesale providers. As per the recent announcement from the Government of Canada, wholesale providers are a proven method of affording competition for broadband and lowering price. In the case of 94Bell, the company ought to know that in many cases, Bell Wireless subscribers have few other choices for broadband, and in addition, are typically service by Bell wireline voice. Noting that the company directs its wireline rollouts, Bell has no incentive to upgrade Bell Wireless 94 Statement by the Government of Canada on Bell Canada petition of CRTC wholesale decision [11 May 16]

http://news.gc.ca/web/article-en.do?nid=1063779
http://news.gc.ca/web/article-en.do?nid=1063779

subscribers from to wireline noting the rates detailed in Table 3, and availability of wholesale options.

160. The Bell response to the above para regarding wholesale providers will likely be that the Bell Hubs are a mobile internet solution, while the fixed wireless is the home solution. My response to the anticipated question is to compare the rates, compare the service areas, and most importantly, ask Bell to state how the frequencies, technologies and networks differ in comparing fixed vs mobile internet.

161. If an incumbent company chooses to serve by wireless, subscribers should not be disadvantaged by the Corporation's choices in its failure to provide comparable services no matter the corporations challenges in affording service. Incumbent companies are presently affording service in communities using wireless, yet often fail to afford broadband using wireline. **** incumbents afford wireless service at far higher cost to the subscriber to the advantage of the corporation. This is a disadvantageous practice, and must stop.

162. What I believe is the appropriate solution is to simply follow the objectives of the Telecommunications Act, and particularly enforce said objectives on incumbent companies.

163. I would like to note the following within the Telecommunications Act:

a. “Subject to any contrary provision in any Act other than this Act or any special Act, the Commission may, by order, in the exercise of its powers under this Act or any special Act, require or permit any telecommunications facilities to be provided, constructed, installed, altered, moved, operated, used, repaired or maintained or any property to be acquired or any system or method to be adopted, by any person interested in or affected by the order, and at or within such time, subject to such conditions as to compensation or otherwise and under such supervision as the Commission determines to be just and expedient.”

b. “The Commission may specify by whom, in what proportion and at or within what time the cost of doing any­thing required or (1) shall be paid.” 95164. I will note, that said paras in the act allude to compensation. I would like to emphasize that it is the Commission that decides compensation, to include the proportion. My response to this is poignant in that I believe as little a proportion as possible should be allocated for companies who have profited by the non­provision of service, or the provision of disadvantageous rate plans to subscribers within a wireline community. It is my belief that the companies have already been compensated enough through the present rate plans.

95 Telecommunications Act, Para 42, Subparas (1) (2)

https://drive.google.com/file/d/0BwEjDkzP4A3qUDVIYXpWVWRNLVU/view?usp=sharing165. In closing, I would like to thank the Commission for the opportunity to present my viewpoints on the circumstances of broadband within my community and on topics that affect many Canadians.

**** C. ****
[address redacted]
[address available to Commission]

Final Submission : Intervenor 54

Document Name: 2015-134.221977.2612151.Final Submission (1jzjr01!).pdf

Attachments A thru C &

Bell Fibe TV and Bell Satellite TV Pricing Final Submission CRTC 2015-134 by **** Adams, Intervener CRTC 2015-134https://services.crtc.gc.ca/Pub/ListeInterventionList/Documents.aspx?ID=221977&en=2015-134&dt=i&lang=e&S=O&PA=t&PT=nc&PST=a¼

¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼¼
¼
¼
¼ ¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
¼
FFF
F
F
F
F
F
F
F
F
F
F
FF
F
F

\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\QuébecQuébecQuébecQuébecQuébecQuébecQuébecQuébecQuébecQuébecBANCROFTBANCROFTBANCROFTBANCROFTBANCROFTBANCROFTBANCROFTBANCROFTBANCROFTDENBIGHDENBIGHDENBIGHDENBIGHDENBIGHDENBIGHDENBIGHDENBIGHDENBIGHCOBDENCOBDENCOBDENCOBDENCOBDENCOBDENCOBDENCOBDENCOBDENEGANVILLEEGANVILLEEGANVILLEEGANVILLEEGANVILLEEGANVILLEEGANVILLEEGANVILLEEGANVILLEKILLALOEKILLALOEKILLALOEKILLALOEKILLALOEKILLALOEKILLALOEKILLALOEKILLALOEARNPRIORARNPRIORARNPRIORARNPRIORARNPRIORARNPRIORARNPRIORARNPRIORARNPRIORBRITANNIABRITANNIABRITANNIABRITANNIABRITANNIABRITANNIABRITANNIABRITANNIABRITANNIACARLETON PLACECARLETON PLACECARLETON PLACECARLETON PLACECARLETON PLACECARLETON PLACECARLETON PLACECARLETON PLACECARLETON PLACERIDEAURIDEAURIDEAURIDEAURIDEAURIDEAURIDEAURIDEAURIDEAUVVVVVVVVVO'CONNORO'CONNORO'CONNORO'CONNORO'CONNORO'CONNORO'CONNORO'CONNORO'CONNORCITYVIEWCITYVIEWCITYVIEWCITYVIEWCITYVIEWCITYVIEWCITYVIEWCITYVIEWCITYVIEWWHITNEYWHITNEYWHITNEYWHITNEYWHITNEYWHITNEYWHITNEYWHITNEYWHITNEYSMITHS FALLSSMITHS FALLSSMITHS FALLSSMITHS FALLSSMITHS FALLSSMITHS FALLSSMITHS FALLSSMITHS FALLSSMITHS FALLSLaurentian ValleyLaurentian ValleyLaurentian ValleyLaurentian ValleyLaurentian ValleyLaurentian ValleyLaurentian ValleyLaurentian ValleyLaurentian ValleyPetawawaPetawawaPetawawaPetawawaPetawawaPetawawaPetawawaPetawawaPetawawa**** Algona WilberforceNorth Algona WilberforceNorth Algona WilberforceNorth Algona WilberforceNorth Algona WilberforceNorth Algona WilberforceNorth Algona WilberforceNorth Algona WilberforceNorth Algona WilberforceKillaloe, **** and RichardsKillaloe, **** and RichardsKillaloe, **** and RichardsKillaloe, **** and RichardsKillaloe, **** and RichardsKillaloe, **** and RichardsKillaloe, **** and RichardsKillaloe, **** and RichardsKillaloe, **** and ****McNab/BraesideMcNab/BraesideMcNab/BraesideMcNab/BraesideMcNab/BraesideMcNab/BraesideMcNab/BraesideMcNab/BraesideMcNab/Braeside**** FrontenacNorth FrontenacNorth FrontenacNorth FrontenacNorth FrontenacNorth FrontenacNorth FrontenacNorth FrontenacNorth Frontenac**** GrenNorth GrenNorth GrenNorth GrenNorth GrenNorth GrenNorth GrenNorth GrenNorth Gren613613613613613613613613613ALMONTEALMONTEALMONTEALMONTEALMONTEALMONTEALMONTEALMONTEALMONTECALABOGIECALABOGIECALABOGIECALABOGIECALABOGIECALABOGIECALABOGIECALABOGIECALABOGIECARPCARPCARPCARPCARPCARPCARPCARPCARPCONSTANCE BAYCONSTANCE BAYCONSTANCE BAYCONSTANCE BAYCONSTANCE BAYCONSTANCE BAYCONSTANCE BAYCONSTANCE BAYCONSTANCE BAYCHALK RIVERCHALK RIVERCHALK RIVERCHALK RIVERCHALK RIVERCHALK RIVERCHALK RIVERCHALK RIVERCHALK RIVERCARDIFFCARDIFFCARDIFFCARDIFFCARDIFFCARDIFFCARDIFFCARDIFFCARDIFFDEEP RIVERDEEP RIVERDEEP RIVERDEEP RIVERDEEP RIVERDEEP RIVERDEEP RIVERDEEP RIVERDEEP RIVERFOYMOUNTFOYMOUNTFOYMOUNTFOYMOUNTFOYMOUNTFOYMOUNTFOYMOUNTFOYMOUNTFOYMOUNTJOCKVALEJOCKVALEJOCKVALEJOCKVALEJOCKVALEJOCKVALEJOCKVALEJOCKVALEJOCKVALEKEMPTVILKEMPTVILKEMPTVILKEMPTVILKEMPTVILKEMPTVIKEMPTVIKEMPTVIKEMPTVILKANATAKANATAKANATAKANATAKANATAKANATAKANATAKANATAKANATALANARKLANARKLANARKLANARKLANARKLANARKLANARKLANARKLANARKMAYNOOTHMAYNOOTHMAYNOOTHMAYNOOTHMAYNOOTHMAYNOOTHMAYNOOTHMAYNOOTHMAYNOOTHPAKENHAMPAKENHAMPAKENHAMPAKENHAMPAKENHAMPAKENHAMPAKENHAMPAKENHAMPAKENHAMRICHMONDRICHMONDRICHMONDRICHMONDRICHMONDRICHMONDRICHMONDRICHMONDRICHMONDRENFREWRENFREWRENFREWRENFREWRENFREWRENFREWRENFREWRENFREWRENFREWROLPHTONROLPHTONROLPHTONROLPHTONROLPHTONROLPHTONROLPHTONROLPHTONROLPHTONSTITTSVILLESTITTSVILLESTITTSVILLESTITTSVILLESTITTSVILLESTITTSVILLESTITTSVILLESTITTSVILLESTITTSVILLEERFORCEERFORCEERFORCEERFORCEERFORCEERFORCEERFORCEERFORCEERFORCEGOLDEN LAKEGOLDEN LAKEGOLDEN LAKEGOLDEN LAKEGOLDEN LAKEGOLDEN LAKEGOLDEN LAKEGOLDEN LAKEGOLDEN LAKEMCDONALDS CORNERSMCDONALDS CORNERSMCDONALDS CORNERSMCDONALDS CORNERSMCDONALDS CORNERSMCDONALDS CORNERSMCDONALDS CORNERSMCDONALDS CORNERSMCDONALDS CORNERSPLEVNAPLEVNAPLEVNAPLEVNAPLEVNAPLEVNAPLEVNAPLEVNAPLEVNAPALMER RAPIDSPALMER RAPIDSPALMER RAPIDSPALMER RAPIDSPALMER RAPIDSPALMER RAPIDSPALMER RAPIDSPALMER RAPIDSPALMER RAPIDSPETAWAWAPETAWAWAPETAWAWAPETAWAWAPETAWAWAPETAWAWAPETAWAWAPETAWAWAPETAWAWABARRY'S BAYBARRY'S BAYBARRY'S BAYBARRY'S BAYBARRY'S BAYBARRY'S BAYBARRY'S BAYBARRY'S BAYBARRY'S BAYDOUGLASDOUGLASDOUGLASDOUGLASDOUGLASDOUGLASDOUGLASDOUGLASDOUGLASNORTH GOWERNORTH GOWERNORTH GOWERNORTH GOWERNORTH GOWERNORTH GOWERNORTH GOWERNORTH GOWERNORTH GOWERPEMBROKEPEMBROKEPEMBROKEPEMBROKEPEMBROKEPEMBROKEPEMBROKEPEMBROKEPEMBROKEIONAIONAIONAIONAIONAIONAIONAIONAIONAMANOTICKMANOTICKMANOTICKMANOTICKMANOTICKMANOTICKMANOTICKMANOTICKMANOTICK281-2281-2281-2281-2281-2281-2281-2281-2281-2380-1380-1380-1380-1380-1380-1380-1380-1380-1281-1281-1281-1281-1281-1281-1281-1281-1281-1182-1182-1182-1182-1182-1182-1182-1182-1182-1360-1360-1360-1360-1360-1360-1360-1360-1360-1181-1181-1181-1181-1181-1181-1181-1181-1181-1281-1281-1281-1281-1281-1281-1281-1281-1281-1160-1160-1160-1160-1160-1160-1160-1160-1160-1102-0102-0102-0102-0102-0102-0102-0102-0102-0301-0301-0301-0301-0301-0301-0301-0301-0301-0280-1280-1280-1280-1280-1280-1280-1280-1280-1301-0301-0301-0301-0301-0301-0301-0301-0301-0380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1380-1180-1180-1180-1180-1180-1180-1180-1180-1180-1481-1481-1481-1481-1481-1481-1481-1481-1481-1480-1480-1480-1480-1480-1480-1480-1480-1480-1180-1180-1180-1180-1180-1180-1180-1180-1180-1183-1183-1183-1183-1183-1183-1183-1183-1183-1286-1286-1286-1286-1286-1286-1286-1286-1286-1181-1181-1181-1181-1181-1181-1181-1181-1181-1281-1281-1281-1281-1281-1281-1281-1281-1281-1283-1283-1283-1283-1283-1283-1283-1283-1283-1281-1281-1281-1281-1281-1281-1281-1281-1281-1380-1380-1380-1380-1380-1380-1380-1380-1380-1186-1186-1186-1186-1186-1186-1186-1186-1186-1283-2283-2283-2283-2283-2283-2283-2283-2283-2361-1361-1361-1361-1361-1361-1361-1361-1361-1382-1382-1382-1382-1382-1382-1382-1382-1382-1284-1284-1284-1284-1284-1284-1284-1284-1284-1266-1266-1266-1266-1266-1266-1266-1266-1266-1161-1161-1161-1161-1161-1161-1161-1161-1161-1401-0401-0401-0401-0401-0401-0401-0401-0401-0362-2362-2362-2362-2362-2362-2362-2362-2362-2111-0111-0111-0111-0111-0111-0111-0111-0111-0302-0302-0302-0302-0302-0302-0302-0302-0302-0263-3263-3263-3263-3263-3263-3263-3263-3263-3162-1162-1162-1162-1162-1162-1162-1162-1162-1182-2182-2182-2182-2182-2182-2182-2182-2182-2504-0504-0504-0504-0504-0504-0504-0504-0504-0381-1381-1381-1381-1381-1381-1381-1381-1381-1160-2160-2160-2160-2160-2160-2160-2160-2160-2161-2161-2161-2161-2161-2161-2161-2161-2161-2780-1780-1780-1780-1780-1780-1780-1780-1780-1180-1180-1180-1180-1180-1180-1180-1180-1180-1181-1181-1181-1181-1181-1181-1181-1181-1181-1283-2283-2283-2283-2283-2283-2283-2283-2283-2207-0207-0207-0207-0207-0207-0207-0207-0207-0282-1282-1282-1282-1282-1282-1282-1282-1282-1160-1160-1160-1160-1160-1160-1160-1160-1160-1481-2481-2481-2481-2481-2481-2481-2481-2481-2482-1482-1482-1482-1482-1482-1482-1482-1482-1302-0302-0302-0302-0302-0302-0302-0302-0302-0389-2389-2389-2389-2389-2389-2389-2389-2389-2302-0302-0302-0302-0302-0302-0302-0302-0302-0180-1180-1180-1180-1180-1180-1180-1180-1180-1187-1187-1187-1187-1187-1187-1187-1187-1187-1203-0203-0203-0203-0203-0203-0203-0203-0203-0480-1480-1480-1480-1480-1480-1480-1480-1480-1261-2261-2261-2261-2261-2261-2261-2261-2261-2301-0301-0301-0301-0301-0301-0301-0301-0301-0382-1382-1382-1382-1382-1382-1382-1382-1382-1303-0303-0303-0303-0303-0303-0303-0303-0303-0307-0307-0307-0307-0307-0307-0307-0307-0307-0460-1460-1460-1460-1460-1460-1460-1460-1460-1405-0405-0405-0405-0405-0405-0405-0405-0405-0608-0608-0608-0608-0608-0608-0608-0608-0608-0105-0105-0105-0105-0105-0105-0105-0105-0105-0103-0103-0103-0103-0103-0103-0103-0103-0103-0387-1387-1387-1387-1387-1387-1387-1387-1387-1361-2361-2361-2361-2361-2361-2361-2361-2361-2183-1183-1183-1183-1183-1183-1183-1183-1183-1509-1509-1509-1509-1509-1509-1509-1509-1509-1266-3266-3266-3266-3266-3266-3266-3266-3266-3402-0402-0402-0402-0402-0402-0402-0402-0402-0381-1381-1381-1381-1381-1381-1381-1381-1381-1406-0406-0406-0406-0406-0406-0406-0406-0406-0601-0601-0601-0601-0601-0601-0601-0601-0601-0702-0702-0702-0702-0702-0702-0702-0702-0702-0101-0101-0101-0101-0101-0101-0101-0101-0101-0161-1161-1161-1161-1161-1161-1161-1161-1161-1483-1483-1483-1483-1483-1483-1483-1483-1483-1280-1280-1280-1280-1280-1280-1280-1280-1280-1290-1290-1290-1290-1290-1290-1290-1290-1290-1881-1881-1881-1881-1881-1881-1881-1881-1881-1581-1581-1581-1581-1581-1581-1581-1581-1581-1281 2281 2281 2281 2281 2281 2281 2281 2281 2261-2261-2261-2261-2261-2261-2261-2261-2261-2180-1180-1180-1180-1180-1180-1180-1180-1180-1186-1186-1186-1186-1186-1186-1186-1186-1186-1101-0101-0101-0101-0101-0101-0101-0101-0101-0102-0102-0102-0102-0102-0102-0102-0102-0102-0403-0403-0403-0403-0403-0403-0403-0403-0403-0184-1184-1184-1184-1184-1184-1184-1184-1184-1281-1281-1281-1281-1281-1281-1281-1281-1281-1284-2284-2284-2284-2284-2284-2284-2284-2284-2383-1383-1383-1383-1383-1383-1383-1383-1383-1283-5283-5283-5283-5283-5283-5283-5283-5283-5506-0506-0506-0506-0506-0506-0506-0506-0506-0163-1163-1163-1163-1163-1163-1163-1163-1163-1880-1880-1880-1880-1880-1880-1880-1880-1880-1262-1262-1262-1262-1262-1262-1262-1262-1262-1285-1285-1285-1285-1285-1285-1285-1285-1285-1361-1361-1361-1361-1361-1361-1361-1361-1361-1104-0104-0104-0104-0104-0104-0104-0104-0104-0190-1190-1190-1190-1190-1190-1190-1190-1190-1580-1580-1580-1580-1580-1580-1580-1580-1580-1280-1280-1280-1280-1280-1280-1280-1280-1280-1360-1360-1360-1360-1360-1360-1360-1360-1360-1283-3283-3283-3283-3283-3283-3283-3283-3283-3261-1261-1261-1261-1261-1261-1261-1261-1261-1301-0301-0301-0301-0301-0301-0301-0301-0301-0217-0217-0217-0217-0217-0217-0217-0217-0217-0403-0403-0403-0403-0403-0403-0403-0403-0403-0614-0614-0614-0614-0614-0614-0614-0614-0614-0106-0106-0106-0106-0106-0106-0106-0106-0106-0284-2284-2284-2284-2284-2284-2284-2284-2284-2103-0103-0103-0103-0103-0103-0103-0103-0103-0450-1450-1450-1450-1450-1450-1450-1450-1450-1382-1382-1382-1382-1382-1382-1382-1382-1382-1269-0269-0269-0269-0269-0269-0269-0269-0269-0182-1182-1182-1182-1182-1182-1182-1182-1182-1483-2483-2483-2483-2483-2483-2483-2483-2483-2101-0101-0101-0101-0101-0101-0101-0101-0101-0219-0219-0219-0219-0219-0219-0219-0219-0219-0392-1392-1392-1392-1392-1392-1392-1392-1392-1209-0209-0209-0209-0209-0209-0209-0209-0209-0111-0111-0111-0111-0111-0111-0111-0111-0111-0182-1182-1182-1182-1182-1182-1182-1182-1182-1102-0102-0102-0102-0102-0102-0102-0102-0102-0202-0202-0202-0202-0202-0202-0202-0202-0202-0CO

UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9

COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509RD

50
9
RD
50
9
D
50
9
RD
50
9
D
50
9
RD
50
9
RD
50
9
D
50
9
RD
50
9
Y
41
Y
41
Y

41 Y 41

Y

41 Y 41

Y
41
Y
41
Y
41

EGIONAL

RD 506

GIONAL RD 506

GIONAL RD 506

EGIONAL

RD 506

GIONAL RD 506

EGIONAL

RD 506

GIONAL RD 506

GIONAL RD 506

GIONAL RD 506

COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509CO

UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
CO
UN
TY
RD
50
9
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL EPH AN T L AKE RD

EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D
EL
EP
H A
NT
L
A
KE
R
D

R EGIO

N AL R D 9

R EGIO

N AL R D 9

R EGIO

N AL R D 9

R EGIO

N AL R D 9

R EGIO

N AL R D 9

R EGIO

N AL R D 9

R EGIO

N AL R D 9

R EGIO

N AL R D 9

R EGIO

N AL R D 9

REG
I O

NAL RD 9REG

I O

NAL RD 9REG

I O

NAL RD 9REG

I O

NAL RD 9REG

I O

NAL RD 9REG

I O

NAL RD 9REG

I O

NAL RD 9REG

I O

NAL RD 9REG

I O

NAL RD 9R E

G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9
R E
G
IO
NA
L
RD
9

HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWA

Y 28HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28

HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28
HI
GH
W
AY
28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TO
WN
LI
NE
E
TO
WN
LI
NE
E
TO
WN
LI
NE
E
TO
WN
LI
NE
E
TO
WN
LI
NE
E
TO
WN
LI
NE
E
TO
WN
LI
NE
E
TO
WN
LI
NE
E
TO
WN
LI
NE
E

REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29CO

UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N

COUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCO

UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N

COUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29 NCOUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29COUNTY RD 29CO

UN
TY
R
D
29
CO
UN
TY
R
D
29
CO
UN
TY
R
D
29
CO
UN
TY
R
D
29
CO
UN
TY
R
D
29
CO
UN
TY
R
D
29
CO
UN
TY
R
D
29
CO
UN
TY
R
D
29
CO
UN
TY
R
D
29

ROSEROSEROS

ROSEROS

ROSEROSEROS

ROSECOUNTY RD 43COUNTY RD 43COUNTY RD 43COUNTY RD 43COUNTY RD 43COUNTY RD 43COUNTY RD 43COUNTY RD 43COUNTY RD 43PA

NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
OT
TA
WA
ST
OT
TA
WA
ST
OT
TA
WA
ST
OT
TA
WA
ST
OT
TA
WA
ST
OT
TA
WA
ST
OT
TA
WA
ST
OT
TA
WA
ST
OT
TA
WA
ST

FRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDHIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HI

G
HW
A
Y
15
H I
G
HW
A
Y
15
H I
G
HW
A
Y
15
H I
G
HW
A
Y
15
H I
G
HW
A
Y
15
H I
G
HW
A
Y
15
H I
G
HW
A
Y
15
H I
G
HW
A
Y
15
H I
G
HW
A
Y
15

HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15HIGHWAY 15H IGHW

AY 15H IGHW

AY 15H IGHW

AY 15H IGHW

AY 15H IGHW

AY 15H IGHW

AY 15H IGHW

AY 15H IGHW

AY 15H IGHW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15W

AY
1
5
AY
1
5
AY
1
5
W
AY
1
5
AY
1
5
W
AY
1
5
AY
1
5
AY
1
5
AY
1
5
H
IG
HW

AY 7H

IG
HW

AY 7H

IG
HW

AY 7H

IG
HW

AY 7H

IG
HW

AY 7H

IG
HW

AY 7H

IG
HW

AY 7H

IG
HW

AY 7H

IG
HW

AY 7HI

GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7

HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7STSTSTST

STS

TSTSTSTPE

RT
H R
D
PE
RT
H R
D
PE
RT
H R
D
PE
RT
H R
D
PE
RT
H R
D
PE
RT
H R
D
PE
RT
H R
D
PE
RT
H R
D
PE
RT
H R
D
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
PE
RT
H
RD
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ESS
ION
RD
2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
CO
NC
ES
SIO
N R
D 2
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR

HERITAGE DRHERITAGE DRHERITAGE DRHERITAGE DRHERITAGE DRHERITAGE DRHERITAGE DRHERITAGE DRHERITAGE DRHE

RI
TA
GE
D
R
HE
RI
TA
GE
D
R
HE
RI
TA
GE
D
R
HE
RI
TA
GE
D
R
HE
RI
TA
GE
D
R
HE
RI
TA
GE
D
R
HE
RI
TA
GE
D
R
HE
RI
TA
GE
D
R
HE
RI
TA
GE
D
R
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D
KI
NB
UR
N
SID
E R
D

WEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDFE

RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
FE
RG
US
ON
F
AL
LS
R
D
W

ILSON STW

ILSON STW

ILSON STW

ILSON STW

ILSON STW

ILSON STW

ILSON STW

ILSON STW

ILSON STSH

AW
R
D
SH
AW
R
D
SH
AW
R
D
SH
AW
R
D
SH
AW
R
D
SH
AW
R
D
SH
AW
R
D
SH
AW
R
D
SH
AW
R
D

COUNTYCOUNTYCOUNTYCOUNTYCOUNTYCOUNTYCOUNTYCOUNTYCOUNTYY RD 20

Y RD 20

RD 20

Y RD 20

RD 20

Y RD 20

Y RD 20

RD 20

Y RD 20

CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43

HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HI

GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1

DUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDMA

RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D

CARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDHIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17DUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDTH

OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
TH
OM
AS
A.
DO
LA
N P
KY
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D

UPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDKIN

BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17FIT

ZR
OY
ST
FIT
ZR
OY
ST
FIT
ZR
OY
ST
FIT
ZR
OY
ST
FIT
ZR
OY
ST
FIT
ZR
OY
ST
FIT
ZR
OY
ST
FIT
ZR
OY
ST
FIT
ZR
OY
ST
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
GA
LE
TT
A S
IDE
RD
SC
H U
T T
R
D
S C
H U
T T
R
D
S C
H U
T T
R
D
S C
H U
T T
R
D
S C
H U
T T
R
D
S C
H U
T T
R
D
S C
H U
T T
R
D
S C
H U
T T
R
D
S C
H U
T T
R
D
B

RUDENE LL RDB

RUDENE LL RDB

RUDENE LL RDB

RUDENE LL RDB

RUDENE LL RDB

RUDENE LL RDB

RUDENE LL RDB

RUDENE LL RDB

RUDENE LL RDCOUNTY RD 512COUNTY RD 512COUNTY RD 512COUNTY RD 512COUNTY RD 512COUNTY RD 512COUNTY RD 512COUNTY RD 512COUNTY RD 512HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41
HIG
HWA

Y 41HIG

HWA

Y 41HIG

HWA

Y 41HIG

HWA

Y 41HIG

HWA

Y 41HIG

HWA

Y 41HIG

HWA

Y 41HIG

HWA

Y 41HIG

HWA

Y 41HI

GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1

HIGHWAY 132HIGHWAY 132HIGHWAY 132HIGHWAY 132HIGHWAY 132HIGHWAY 132HIGHWAY 132HIGHWAY 132HIGHWAY 132HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60CO

UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
RD
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
CO
UN
TY
R
D
34
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D
LA
PA
SS
E R
D

FORESTERS FALLS RDFORESTERS FALLS RDFORESTERS FALLS RDFORESTERS FALLS RDFORESTERS FALLS RDFORESTERS FALLS RDFORESTERS FALLS RDFORESTERS FALLS RDFORESTERS FALLS RDFO

RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
FO
RE
ST
ER
S F
AL
LS
RD
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HI

GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2

LISGAR AVE

LISGAR AVE

LISGAR AVE

LISGAR AVE

LISGAR AVE

LISGAR AVE

LISGAR AVE

LISGAR AVE

LISGAR AVEB

RU
CE
ST
BR
UC
E S
T
BR
UC
E S
T
BR
UC
E S
T
BR
UC
E S
T
BR
UC
E S
T
BR
UC
E S
T
BR
UC
E S
T
BR
UC
E S
T

RAGLAN ST SRAGLAN ST SRAGLAN ST SRAGLAN ST SRAGLAN ST SRAGLAN ST SRAGLAN ST SRAGLAN ST SRAGLAN ST SCOUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511GILLAN RDGILLAN RDGILLAN RDGILLAN RDGILLAN RDGILLAN RDGILLAN RDGILLAN RDGILLAN RDST

OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
ST
OR
YL
AN
D R
D
CO
UN
TY
RD
20
CO
UN
TY
RD
20
CO
UN
TY
RD
20
CO
UN
TY
RD
20
CO
UN
TY
RD
20
CO
UN
TY
RD
20
CO
UN
TY
RD
20
CO
UN
TY
RD
20
CO
UN
TY
RD
20

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17GIL

LA
N R
D
GIL
LA
N R
D
GIL
LA
N R
D
GIL
LA
N R
D
GIL
LA
N R
D
GIL
LA
N R
D
GIL
LA
N R
D
GIL
LA
N R
D
GIL
LA
N R
D

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17COUNTY RD 63COUNTY RD 63COUNTY RD 63COUNTY RD 63COUNTY RD 63COUNTY RD 63COUNTY RD 63COUNTY RD 63COUNTY RD 63AN

DE
RS
O
N
RD
AN
DE
RS
O
N
RD
AN
DE
RS
O
N
RD
AN
DE
RS
O
N
RD
AN
DE
RS
O
N
RD
AN
DE
RS
O
N
RD
AN
DE
RS
O
N
RD
AN
DE
RS
O
N
RD
AN
DE
RS
O
N
RD
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
CO
UN
TY
R
D
6
RU
SS
ET
T D
R
RU
SS
ET
T D
R
RU
SS
ET
T D
R
RU
SS
ET
T D
R
RU
SS
ET
T D
R
RU
SS
ET
T D
R
RU
SS
ET
T D
R
RU
SS
ET
T D
R
RU
SS
ET
T D
R

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17DA

NIE
L S
T S
DA
NIE
L S
T S
DA
NIE
L S
T S
DA
NIE
L S
T S
DA
NIE
L S
T S
DA
NIE
L S
T S
DA
NIE
L S
T S
DA
NIE
L S
T S
DA
NIE
L S
T S

RUSSETT DRRUSSETT DRRUSSETT DRRUSSETT DRRUSSETT DRRUSSETT DRRUSSETT DRRUSSETT DRRUSSETT DRELGIN ST WELGIN ST WELGIN ST WELGIN ST WELGIN ST WELGIN ST WELGIN ST WELGIN ST WELGIN ST WHIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17MADAWASKA BLVDMADAWASKA BLVDMADAWASKA BLVDMADAWASKA BLVDMADAWASKA BLVDMADAWASKA BLVDMADAWASKA BLVDMADAWASKA BLVDMADAWASKA BLVDCO

UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8
HI
GH
W
AY
2
8

HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIG

HW
AY
28
HIG
HW
AY
28
HIG
HW
AY
28
HIG
HW
AY
28
HIG
HW
AY
28
HIG
HW
AY
28
HIG
HW
AY
28
HIG
HW
AY
28
HIG
HW
AY
28

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

VICTORIA ST

VICTORIA ST

VICTORIA STVICTORIA ST

VICTORIA STVICTORIA ST

VICTORIA ST

VICTORIA STVICTORIA ST

COUNTY RD 21COUNTY RD 21COUNTY RD 21COUNTY RD 21COUNTY RD 21COUNTY RD 21COUNTY RD 21COUNTY RD 21COUNTY RD 21DORAN STDORAN STDORAN STDORAN STDORAN STDORAN STDORAN STDORAN STDORAN STLAURENTIAN DRLAURENTIAN DRLAURENTIAN DRLAURENTIAN DRLAURENTIAN DRLAURENTIAN DRLAURENTIAN DRLAURENTIAN DRLAURENTIAN DRROU

ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD

DORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WB

LI
NE
R
D
B
LI
NE
R
D
B
LI
NE
R
D
B
LI
NE
R
D
B
LI
NE
R
D
B
LI
NE
R
D
B
LI
NE
R
D
B
LI
NE
R
D
B
LI
NE
R
D

BOUNDARY RD EBOUNDARY RD EBOUNDARY RD EBOUNDARY RD EBOUNDARY RD EBOUNDARY RD EBOUNDARY RD EBOUNDARY RD EBOUNDARY RD EM

ACKA Y STM

ACKA Y STM

ACKA Y STM

ACKA Y STM

ACKA Y STM

ACKA Y STM

ACKA Y STM

ACKA Y STM

ACKA Y STMACKAY STMACKAY STMACKAY STMACKAY STMACKAY STMACKAY STMACKAY STMACKAY STMACKAY STHIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17DUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDHIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417CARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDHIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417DUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDKIN

BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD
KIN
BU
RN
SI
DE
RD

HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417UPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDHIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15HIG

HW

AY 15CARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDFERRY RDFERRY RDFERRY RDFERRY RDFERRY RDFERRY RDFERRY RDFERRY RDFERRY RDHI

G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D
E L
P H
IN
M
A B
E R
LY
R
D

ELPHIN MABERLY RDELPHIN MABERLY RDELPHIN MABERLY RDELPHIN MABERLY RDELPHIN MABERLY RDELPHIN MABERLY RDELPHIN MABERLY RDELPHIN MABERLY RDELPHIN MABERLY RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDBENNETT LAKE RD

BENNETT LAKE RD

BENNETT LAKE RD

BENNETT LAKE RD

BENNETT LAKE RD

BENNETT LAKE RD

BENNETT LAKE RD

BENNETT LAKE RD

BENNETT LAKE RD

MCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDBEN

NET

T LAKE RD

BEN
NET

T LAKE RD

BEN
NET

T LAKE RD

BEN
NET

T LAKE RD

BEN
NET

T LAKE RD

BEN
NET

T LAKE RD

BEN
NET

T LAKE RD

BEN
NET

T LAKE RD

BEN
NET

T LAKE RD

MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D
MC
DO
NA
LD
S C
OR
NE
RS
R
D

FALLBROOK RDFALLBROOK RDFALLBROOK RDFALLBROOK RDFALLBROOK RDFALLBROOK RDFALLBROOK RDFALLBROOK RDFALLBROOK RDFA

LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D
FA
LL
BR
OO
K R
D

HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RD

SOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSO

UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
SO
UT
H L
AV
AN
T R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D
WA
TSO
NS
CO
RN
ER
S R
D

SOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDSOUTH LAVANT RDHIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511TA

TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D

HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIG

HW

AY 5 11HIG

HW

AY 5 11HIG

HW

AY 5 11HIG

HW

AY 5 11HIG

HW

AY 5 11HIG

HW

AY 5 11HIG

HW

AY 5 11HIG

HW

AY 5 11HIG

HW

AY 5 11HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511TATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDPE

NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
PE
NE
SH
UL
A R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TL
OC
K R
D
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
WA
TS
ON
S C
OR
NE
RS
RD
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D
SO
UT
H
LA
VA
NT
R
D

HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511W

AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D
W
AT
SO
NS
C
OR
NE
RS
R
D

WOLF GROVE RDWOLF GROVE RDWOLF GROVE RDWOLF GROVE RDWOLF GROVE RDWOLF GROVE RDWOLF GROVE RDWOLF GROVE RDWOLF GROVE RDHIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HERON M

LLS RDHERON M

LLS RDHERON M

LLS RDHERON M

LLS RDHERON M

LLS RDHERON M

LLS RDHERON M

LLS RDHERON M

LLS RDHERON M

LLS RDGEORGE STGEORGE STGEORGE STGEORGE STGEORGE STGEORGE STGEORGE STGEORGE STGEORGE STPI

NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
R O
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D
PI
NE
G
RO
VE
R
D

FALLBRO

OKE
RD

FALLBRO

OKE
RD

FALLBRO

OKE
RD

FALLBRO

OKE
RD

FALLBRO

OKE
RD

FALLBRO

OKE
RD

FALLBRO

OKE
RD

FALLBRO

OKE
RD

FALLBRO

OKE
RD

HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511CAMPBELL SIDE RDCAMPBELL SIDE RDCAMPBELL SIDE RDCAMPBELL SIDE RDCAMPBELL SIDE RDCAMPBELL SIDE RDCAMPBELL SIDE RDCAMPBELL SIDE RDCAMPBELL SIDE RDCONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4WEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDWEBE RDBE

LL
AM
Y
RD
BE
LL
AM
Y
RD
BE
LL
AM
Y
RD
BE
LL
AM
Y
RD
BE
LL
AM
Y
RD
BE
LL
AM
Y
RD
BE
LL
AM
Y
RD
BE
LL
AM
Y
RD
BE
LL
AM
Y
RD
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
W
OL
F G
RO
VE
R
D
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD
TA
TLO
CK
RD

TATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDWOLF

GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D
WO
LF
GR
OV
E R
D

TATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDTATLOCK RDCOUNTY RD 15COUNTY RD 15COUNTY RD 15COUNTY RD 15COUNTY RD 15COUNTY RD 15COUNTY RD 15COUNTY RD 15COUNTY RD 15HI

G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7
HI
G
HW
AY
7

BLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDBLAKENEY RDMARTIN ST NMARTIN ST NMARTIN ST NMARTIN ST NMARTIN ST NMARTIN ST NMARTIN ST NMARTIN ST NMARTIN ST NHIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HI

G
HW
AY
5
11
HI
G
HW
AY
5
11
HI
G
HW
AY
5
11
HI
G
HW
AY
5
11
HI
G
HW
AY
5
11
HI
G
HW
AY
5
11
HI
G
HW
AY
5
11
HI
G
HW
AY
5
11
HI
G
HW
AY
5
11

HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511PIN

E G
RO
VE
RD
PIN
E G
RO
VE
RD
PIN
E G
RO
VE
RD
PIN
E G
RO
VE
RD
PIN
E G
RO
VE
RD
PIN
E G
RO
VE
RD
PIN
E G
RO
VE
RD
PIN
E G
RO
VE
RD
PIN
E G
RO
VE
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
FE
RG
US
ON
FA
LL
S
RD
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
H
W
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7
H
IG
HW
AY
7

HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HIGHWAY 7HI GHW

A Y 7HI GHW

A Y 7HI GHW

A Y 7HI GHW

A Y 7HI GHW

A Y 7HI GHW

A Y 7HI GHW

A Y 7HI GHW

A Y 7HI GHW

A Y 7HI

GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7
HI
GH
W
AY
7

434334334343343HIG

HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
LIN
E R
D 9
LIN
E R
D 9
LIN
E R
D 9
LIN
E R
D 9
LIN
E R
D 9
LIN
E R
D 9
LIN
E R
D 9
LIN
E R
D 9
LIN
E R
D 9

APPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDCEMETERY SIDE RDRIC

HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RO

SEDALE RD SRO

SEDALE RD SRO

SEDALE RD SRO

SEDALE RD SRO

SEDALE RD SRO

SEDALE RD SRO

SEDALE RD SRO

SEDALE RD SRO

SEDALE RD SHIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60 HIGHWAY 60

HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60 HIGHW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HI

G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HI
G
HW
AY
5
2 3
HIG
HW

AY 52 3HIG

HW

AY 52 3HIG

HW

AY 52 3HIG

HW

AY 52 3HIG

HW

AY 52 3HIG

HW

AY 52 3HIG

HW

AY 52 3HIG

HW

AY 52 3HIG

HW

AY 52 3HIG

HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0

HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIG

HW
A

Y 1 7H IGHW

A

Y 1 7H IGHW

A

Y 1 7H IGHW

A

Y 1 7H IGHW

A

Y 1 7H IGHW

A

Y 1 7H IGHW

A

Y 1 7H IGHW

A

Y 1 7H IGHW

A

Y 1 7HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60 HIGHWAY 523HIGHWAY 523HIGHWAY 523HIGHWAY 523HIGHWAY 523HIGHWAY 523HIGHWAY 523HIGHWAY 523HIGHWAY 523HI

GH
W
AY
52
3
HI
GH
W
AY
52
3
HI
GH
W
AY
52
3
HI
GH
W
AY
52
3
HI
GH
W
AY
52
3
HI
GH
W
AY
52
3
HI
GH
W
AY
52
3
HI
GH
W
AY
52
3
HI
GH
W
AY
52
3

HIGHWAY 60

HIGHWAY 60

HIGHWAY 60

HIGHWAY 60

HIGHWAY 60

HIGHWAY 60

HIGHWAY 60

HIGHWAY 60

HIGHWAY 60

HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
G
HW
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

HIGHWAY

41

PET ERSO

N RDP ET ERSO

N RDP ET ERSO

N RDP ET ERSO

N RDP ET ERSO

N RDP ET ERSO

N RDP ET ERSO

N RDP ET ERSO

N RDP ET ERSO

N RDEL

EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D
EL
EP
HA
NT
LA
KE
R
D

ELEPHANT LAKE RDELEPHANT LAKE RDELEPHANT LAKE RDELEPHANT LAKE RDELEPHANT LAKE RDELEPHANT LAKE RDELEPHANT LAKE RDELEPHANT LAKE RDELEPHANT LAKE RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDCOUNTY RD 635COUNTY RD 635COUNTY RD 635COUNTY RD 635COUNTY RD 635COUNTY RD 635COUNTY RD 635COUNTY RD 635COUNTY RD 635RIV

ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD

COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23HIG

HW

AY 127H IGHW

AY 127H IGHW

AY 127H IGHW

AY 127H IGHW

AY 127H IGHW

AY 127H IGHW

AY 127H IGHW

AY 127H IGHW

AY 127H IGHW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62RE

GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D

62 REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62RE

GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62
RE
GI
ON
AL
R
D
62

REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REGIONAL RD 62REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

REG

IONAL RD 62

HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62H I

GH
W
AY
6
2
H I
GH
W
AY
6
2
H I
GH
W
AY
6
2
H I
GH
W
AY
6
2
H I
GH
W
AY
6
2
H I
GH
W
AY
6
2
H I
GH
W
AY
6
2
H I
GH
W
AY
6
2
H I
GH
W
AY
6
2
HI
GH
W
AY
62
HI
GH
W
AY
62
HI
GH
W
AY
62
HI
GH
W
AY
62
HI
GH
W
AY
62
HI
GH
W
AY
62
HI
GH
W
AY
62
HI
GH
W
AY
62
HI
GH
W
AY
62

HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60 HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60 HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60 OPEONGO LINEOPEONGO LINEOPEONGO LINEOPEONGO LINEOPEONGO LINEOPEONGO LINEOPEONGO LINEOPEONGO LINEOPEONGO LINEOPE

ONG

O LINE

OPE
ONG

O LINE

OPE
ONG

O LINE

OPE
ONG

O LINE

OPE
ONG

O LINE

OPE
ONG

O LINE

OPE
ONG

O LINE

OPE
ONG

O LINE

OPE
ONG

O LINE

HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
HI
GH
W
AY
6
0
W

ILNO RD SW

ILNO RD SW

ILNO RD SW

ILNO RD SW

ILNO RD SW

ILNO RD SW

ILNO RD SW

ILNO RD SW

ILNO RD SJOHN STJOHN STJOHN STJOHN STJOHN STJOHN STJOHN STJOHN STJOHN STCO

M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
M
B
ER
M
ER
E
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
CO
MB
ER
ME
RE
RD
COM

BERMERE RDCOM

BERMERE RDCOM

BERMERE RDCOM

BERMERE RDCOM

BERMERE RDCOM

BERMERE RDCOM

BERMERE RDCOM

BERMERE RDCOM

BERMERE RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDW

IL
NO
R
D
S
W
IL
NO
R
D
S
W
IL
NO
R
D
S
W
IL
NO
R
D
S
W
IL
NO
R
D
S
W
IL
NO
R
D
S
W
IL
NO
R
D
S
W
IL
NO
R
D
S
W
IL
NO
R
D
S
CO
M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

M
B

ER MER

E RDCO

MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
CO
MB
ER
ME
RE
R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D
ROC
KIN
GHA
M R
D

ROCKINGHAM RDROCKINGHAM RDROCKINGHAM RDROCKINGHAM RDROCKINGHAM RDROCKINGHAM RDROCKINGHAM RDROCKINGHAM RDROCKINGHAM RDRO

CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD
RO
CK
ING
HA
M
RD

DAFOE RDDAFOE RDDAFOE RDDAFOE RDDAFOE RDDAFOE RDDAFOE RDDAFOE RDDAFOE RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RD PALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDCO

U

N TY RD 509C O

U

N TY RD 509C O

U

N TY RD 509C O

U

N TY RD 509C O

U

N TY RD 509C O

U

N TY RD 509C O

U

N TY RD 509C O

U

N TY RD 509C O

U

N TY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509COUNTY RD 509BRUDENELL RDBRUDENELL RDBRUDENELL RDBRUDENELL RDBRUDENELL RDBRUDENELL RDBRUDENELL RDBRUDENELL RDBRUDENELL RDRO

UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D
RO
UN
D
LA
KE
R
D

ROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD
ROU

ND LAKE

RD

ROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROUND LAKE RDROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D
ROU
ND
LAK
E R
D

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
HIG
HW
AY
60
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D

HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41H

I G
HW
AY
4
1
H
I G
HW
AY
4
1
H
I G
HW
AY
4
1
H
I G
HW
AY
4
1
H
I G
HW
AY
4
1
H
I G
HW
AY
4
1
H
I G
HW
AY
4
1
H
I G
HW
AY
4
1
H
I G
HW
AY
4
1

HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW

AY 62HIG

HW
AY
HIG
HW
AY
HIG
HW
AY
HIG
HW
AY
HIG
HW
AY
HIG
HW
AY
HIG
HW
AY
HIG
HW
AY
HIG
HW
AY

D 648D 648D 648D 648

D 648D 648D 648D 648D 648COUNTY RD 648

COUNTY RD 648

COUNTY RD 648

COUNTY RD 648

COUNTY RD 648

COUNTY RD 648

COUNTY RD 648

COUNTY RD 648

COUNTY RD 648

CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648C

O

U NTY RD 648COUNTY RD 5

COUNTY RD 5

COUNTY RD 5

COUNTY RD 5

COUNTY RD 5

COUNTY RD 5

COUNTY RD 5

COUNTY RD 5

COUNTY RD 5

CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8
CO
UN
TY
R
D
64
8

HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIG

HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121

REGIONAL RD 9REGIONAL RD 9REGIONAL RD 9REGIONAL RD 9REGIONAL RD 9REGIONAL RD 9REGIONAL RD 9REGIONAL RD 9REGIONAL RD 9HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIGHWAY 121HIG

HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121
HIG
HW
AY
121

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17 HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY

17

HIGHWAY

17

HIGHWAY

17

HIGHWAY

17

HIGHWAY

17

HIGHWAY

17

HIGHWAY

17

HIGHWAY

17

HIGHWAY

17

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17

HIGHWAY 17

HIGHWAY 17HIGHWAY 17

HIGHWAY 17HIGHWAY 17

HIGHWAY 17

HIGHWAY 17HIGHWAY 17

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17RE

GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
RE
GI
ON
AL
R
D
51
7
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8 H
IG
HW
AY
2
8
HI
G
HW
AY
2
8
HI
G
HW
AY
2
8
HI
G
HW
AY
2
8
HI
G
HW
AY
2
8
HI
G
HW
AY
2
8
HI
G
HW
AY
2
8
HI
G
HW
AY
2
8
HI
G
HW
AY
2
8

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HIGHWAY

28

HA STINGS ST NHA STINGS ST NHA STINGS ST NHA STINGS ST NHA STINGS ST NHA STINGS ST NHA STINGS ST NHA STINGS ST NHA STINGS ST NMONCK RDMONCK RDMONCK RDMONCK RDMONCK RDMONCK RDMONCK RDMONCK RDMONCK RDBRIDGE ST E

BRIDGE ST E

BRIDGE ST E

BRIDGE ST E

BRIDGE ST E

BRIDGE ST E

BRIDGE ST E

BRIDGE ST E

BRIDGE ST E

MILL STMILL STMILL STMILL STMILL STMILL STMILL STMILL STMILL STHIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 62HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28SCHUTT RDSCHUTT RDSCHUTT RDSCHUTT RDSCHUTT RDSCHUTT RDSCHUTT RDSCHUTT RDSCHUTT RDSC

HU
TT
R
D
SC
HU
TT
R
D
SC
HU
TT
R
D
SC
HU
TT
R
D
SC
HU
TT
R
D
SC
HU
TT
R
D
SC
HU
TT
R
D
SC
HU
TT
R
D
SC
HU
TT
R
D

PALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RD

PALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDPALMER RDQU

AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
ILL
E R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D
QU
AD
EV
IL
LE
R
D

QUADEVILLE RDQUADEVILLE RDQUADEVILLE RDQUADEVILLE RDQUADEVILLE RDQUADEVILLE RDQUADEVILLE RDQUADEVILLE RDQUADEVILLE RDQ

UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
Q
UA
DE
VI
LL
E
RD
PAL
ME
R R
D
PAL
ME
R R
D
PAL
ME
R R
D
PAL
ME
R R
D
PAL
ME
R R
D
PAL
ME
R R
D
PAL
ME
R R
D
PAL
ME
R R
D
PAL
ME
R R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D
RO
CK
IN
GH
AM
R
D

OPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDO

PEONGO RD

O

PEONGO RD

O

PEONGO RD

O

PEONGO RD

O

PEONGO RD

O

PEONGO RD

O

PEONGO RD

O

PEONGO RD

O

PEONGO RD

FOYMOUNT RD

FOYMOUNT RD

FOYMOUNT RD

FOYMOUNT RD

FOYMOUNT RD

FOYMOUNT RD

FOYMOUNT RD

FOYMOUNT RD

FOYMOUNT RD

APPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDAPPLETON SIDE RDTA

TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD
TA
TL
OC
K
RD

HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417CO

UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N
CO
UN
TY
R
D
29
N

ELEEELEELEEEHIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417HIGHWAY 417REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29REGIONAL RD 29HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIG

HW
AY
41
HIG
HW
AY
41
HIG
HW
AY
41
HIG
HW
AY
41
HIG
HW
AY
41
HIG
HW
AY
41
HIG
HW
AY
41
HIG
HW
AY
41
HIG
HW
AY
41
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8

HEROHEROHEROHEROHEROHEROHEROHEROHEROHUHUHUHHHHHHST

L
AU
RE
NT
B
LV
D
ST
L
AU
RE
NT
B
LV
D
ST
L
AU
RE
NT
B
LV
D
ST
L
AU
RE
NT
B
LV
D
ST
L
AU
RE
NT
B
LV
D
ST
L
AU
RE
NT
B
LV
ST
L
AU
RE
NT
B
LV
ST
L
AU
RE
NT
B
LV
ST
L
AU
RE
NT
B
LV

DST PATRICK STST PATRICK STST PATRICK STST PATRICK STST PATRICK STST PATRICK STST PATRICK STST PATRICK STST PATRICK STW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVECOUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511MCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDMCDONALDS CORNERS RDCOUNTY RD 25COUNTY RD 25COUNTY RD 25COUNTY RD 25COUNTY RD 25COUNTY RD 25COUNTY RD 25COUNTY RD 25COUNTY RD 25CO

UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8
CO
UN
TY
R
D
1 8

RIDEARIDEARIDEARIDEARIDEARIDEARIDEARIDEARIDEACOCOCOCOCOCCCCOCOUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44COUNTY RD 44CO

UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
RI
DE
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
RI
D E
A U
R
IV
E R
R
D
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
CO
UN
TY
R
D
18
RI
DE
AU
RI
DE
AU
RI
DE
AU
RI
DE
A
RI
DE
A
RI
D
RI
D
RI
D
RI
DE
A

SMYTH RDSMYTH RDSMYTH RDSMYTH RD

SMYTH RDSMYTH RDSMYTH RDSMYTH RDSMYTH RDHIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416DO

NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R

4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RDRIDEAU VALLEY DR SRIDEAU VALLEY DR SRIDEAU VALLEY DR SRIDEAU VALLEY DR SRIDEAU VALLEY DR SRIDEAU VALLEY DR RIDEAU VALLEY DR RIDEAU VALLEY DR RIDEAU VALLEY DR SRIDEAURIDEAURIDEAURIDEAURIDEAURIDEARIDEARIDEARIDEAUBA

NKF
IEL
D R
D
BA
NKF
IEL
D R
D
BA
NKF
IEL
D R
D
BA
NKF
IEL
D R
D
BA
NKF
IEL
D R
D
BA
NKF
IEL
D R
D
BA
NKF
IEL
D R
D
BA
NKF
IEL
D R
D
BA
NKF
IEL
D R
D

MANOTICK MAIN STMANOTICK MAIN STMANOTICK MAIN STMANOTICK MAIN STMANOTICK MAIN STMANOTICK MAIN STMANOTICK MAIN STMANOTICK MAIN STMANOTICK MAIN STLEI

TRI
M R
D
LEI
TRI
M R
D
LEI
TRI
M R
D
LEI
TRI
M R
D
LEI
TRI
M R
D
LEI
TRI
M R
D
LEI
TRI
M R
D
LEI
TRI
M R
D
LEI
TRI
M R
D
M

ERIVALE RDM

ERIVALE RDM

ERIVALE RDM

ERIVALE RDM

ERIVALE RDM

ERIVALE RDM

ERIVALE RDM

ERIVALE RDM

ERIVALE RDHAZE

LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D

STITTSVILLE MAIN STSTITTSVILLE MAIN STSTITTSVILLE MAIN STSTITTSVILLE MAIN STSTITTSVILLE MAIN STSTITTSVILLE MAIN STSTITTSVILLE MAIN STSTITTSVILLE MAIN STSTITTSVILLE MAIN STFAL

LOW

FIELD R

D
FAL
LOW

FIELD R

D
FAL
LOW

FIELD R

D
FAL
LOW

FIELD R

D
FAL
LOW

FIELD R

D
FAL
LOW

FIELD R

D
FAL
LOW

FIELD R

D
FAL
LOW

FIELD R

D
FAL
LOW

FIELD R

D

RIVERSIDE DRRIVERSIDE DRRIVERSIDE DRRIVERSIDE DRRIVERSIDE DRRIVERSIDE DRRIVERSIDE DRRIVERSIDE DRRIVERSIDE DRRI

V E
R
RD
RI
V E
R
RD
RI
V E
R
RD
RI
V E
R
RD
RI
V E
R
RD
RI
V E
R
RD
RI
V E
R
RD
RI
V E
R
RD
RI
V E
R
RD

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

PR INCE O

F W

ALES DR

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

MEA
DOW
LAN

DS DR E

PARKDALE AVEPARKDALE AVEPARKDALE AVEPARKDALE AVEPARKDALE AVEPARKDALE AVEPARKDALE AVEPARKDALE AVEPARKDALE AVECA

RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
W
O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEW

O

ODROFFE AVEWE

ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CL
UB
RD
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D
WE
ST
HU
NT
CLU
B R
D H
UN
T
CL
UB
R
D
HU
NT
C
LU
B
RD
HU
NT
C
LU
B
RD
HU
NT
C
LU
B
RD
HU
NT
C
LU
B
RD
HU
NT
C
LU
B
RD
HU
NT
C
LU
B
RD
HU
NT
C
LU
B
RD
HU
NT
C
LU
B
RD

BANK STBANK STBANK STBANK STBANK STBANK STBANK STBANK STBANK STWA

LKL
EY
RD
WA
LKL
EY
RD
WA
LKL
EY
RD
WA
LKL
EY
RD
WA
LKL
EY
RD
WA
LKL
EY
RD
WA
LKL
EY
RD
WA
LKL
EY
RD
WA
LKL
EY
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BAS
ELI
NE
RD
BRO
NSO

N AVEBRO

NSO

N AVEBRO

NSO

N AVEBRO

NSO

N AVEBRO

NSO

N AVEBRO

NSO

N AVEBRO

NSO

N AVEBRO

NSO

N AVEBRO

NSO

N AVECA

RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD
DIL
LW
OR
TH
RD

HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416RO

GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR

ISLAND PARK DRISLAND PARK DRISLAND PARK DRISLAND PARK DRISLAND PARK DRISLAND PARK DRISLAND PARK DRISLAND PARK DRISLAND PARK DRMO

NTR
EAL
RD
MO
NTR
EAL
RD
MO
NTR
EAL
RD
MO
NTR
EAL
RD
MO
NTR
EAL
RD
MO
NTR
EAL
RD
MO
NTR
EAL
RD
MO
NTR
EAL
RD
MO
NTR
EAL
RD
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY
OTT
AW
A R
IVE
R P
KY

CARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDBANK STBANK STBANK STBANK STBANK STBANK STBANK STBANK STBANK STQUEENSWAY

QUEENSWAY

QUEENSWAY

QUEENSWAY

QUEENSWAY

QUEENSWAY

QUEENSWAY

QUEENSWAY

QUEENSWAY

HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HA
ZE
LD
EA
N R
D
HE
ML
OC
K
RD
HE
ML
OC
K
RD
HE
ML
OC
K
RD
HE
ML
OC
K
RD
HE
ML
OC
K
RD
HE
ML
OC
K
RD
HE
ML
OC
K
RD
HE
ML
OC
K
RD
HE
ML
OC
K
RD

JOCKVALE RDJOCKVALE RDJOCKVALE RDJOCKVALE RDJOCKVALE RDJOCKVALE RDJOCKVALE RDJOCKVALE RDJOCKVALE RDRIDEAU VALLEY DRRIDEAU VALLEY DRRIDEAU VALLEY DRRIDEAU VALLEY DRRIDEAU VALLEY DRRIDEAU VALLEY DRRIDEAU VALLEY DRRIDEAU VALLEY DRRIDEAU VALLEY DRMIT

CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
OW
ENS
RD
MIT
CH
MIT
CH
MIT

CHMITCH

MIT

CHMITCH

MIT
CH
MIT

CHMITCH

HUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RD HUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDHUNTLEY RDEAG

LESON RDEAG

LESON RDEAG

LESON RDEAG

LESON RDEAG

LESON RDEAG

LESON RDEAG

LESON RDEAG

LESON RDEAG

LESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDPE

RT
H S
T
PE
RT
H S
T
PE
RT
H S
T
PE
RT
H S
T
PE
RT
H S
T
PE
RT
H S
T
PE
RT
H S
T
PE
RT
H S
T
PE
RT
H S
T
M

ARCH RDM

ARCH RDM

ARCH RDM

ARCH RDM

ARCH RDM

ARCH RDM

ARCH RDM

ARCH RDM

ARCH RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDMUNSTER RDFR

AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D

DWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDCEN

TUR
Y R
D W
CEN
TUR
Y R
D W
CEN
TUR
Y R
D W
CEN
TUR
Y R
D W
CEN
TUR
Y R
D W
CEN
TUR
Y R
D W
CEN
TUR
Y R
D W
CEN
TUR
Y R
D W
CEN
TUR
Y R
D W

MCBEAN STMCBEAN STMCBEAN STMCBEAN STMCBEAN STMCBEAN STMCBEAN STMCBEAN STMCBEAN ST4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RDDIDIDIDDDDDDFISHER AVEFISHER AVEFISHER AVEFISHER AVEFISHER AVEFISHER AVEFISHER AVEFISHER AVEFISHER AVERO

CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY
RO
CK
CL
IF
FE
P
KY

SMSMSMSMSMSSSSMM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRBR

OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
BR
OPH
Y D
R
LIM

EBANK RDLIM

EBANK RDLIM

EBANK RDLIM

EBANK RDLIM

EBANK RDLIM

EBANK RDLIM

EBANK RDLIM

EBANK RDLIM

EBANK RDHIG

HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2

HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 34COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 508COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511COUNTY RD 511CO

UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
R
D 5
08
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
R
D
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8
CO
UN
TY
RD
50
8

COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65 COUNTY RD 65

COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65CO

UN
TY
RD
65
CO
UN
TY
RD
65
CO
UN
TY
RD
65
CO
UN
TY
RD
65
CO
UN
TY
RD
65
CO
UN
TY
RD
65
CO
UN
TY
RD
65
CO
UN
TY
RD
65
CO
UN
TY
RD
65

COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65CO

UN
TY
R
D
65
CO
UN
TY
R
D
65
CO
UN
TY
R
D
65
CO
UN
TY
R
D
65
CO
UN
TY
R
D
65
CO
UN
TY
R
D
65
CO
UN
TY
R
D
65
CO
UN
TY
R
D
65
CO
UN
TY
R
D
65
C O
UN

TY RD 65

C O
UN

TY RD 65

C O
UN

TY RD 65

C O
UN

TY RD 65

C O
UN

TY RD 65

C O
UN

TY RD 65

C O
UN

TY RD 65

C O
UN

TY RD 65

C O
UN

TY RD 65

COU
NTY

RD 508

COU
NTY

RD 508

COU
NTY

RD 508

COU
NTY

RD 508

COU
NTY

RD 508

COU
NTY

RD 508

COU
NTY

RD 508

COU
NTY

RD 508

COU
NTY

RD 508

COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65COUNTY RD 65TERRY FOX DRTERRY FOX DRTERRY FOX DRTERRY FOX DRTERRY FOX DRTERRY FOX DRTERRY FOX DRTERRY FOX DRTERRY FOX DRC

O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
C
O
UN
TY
R
D
71
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD

CARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDCARP RDFA

LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D
FR
AN
KT
OW
N R
D

4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RD4 LINE RDFA

LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD

HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416AIR

PO
RT
PK
Y
AIR
PO
RT
PK
Y
AIR
PO
RT
PK
Y
AIR
PO
RT
PK
Y
AIR
PO
RT
PK
Y
AIR
PO
RT
PK
Y
AIR
PO
RT
PK
Y
AIR
PO
RT
PK
Y
AIR
PO
RT
PK
Y

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDR

I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
R
I V
ER
SI
D
E
D R
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
QU
EE
NS
WA
Y
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
HU
NT
CLU
B R
D
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDPR

IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R
PR
IN
CE
O
F
W
AL
ES
D
R

RIVER RRIVER RRIVER RRIVER RRIVER RRIVER RRIVER RRIVER RRIVER RDO

NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR
DO
NN
EL
LY
DR

HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416OTTAWA RIVER PKYOTTAWA RIVER PKYOTTAWA RIVER PKYOTTAWA RIVER PKYOTTAWA RIVER PKYOTTAWA RIVER PKYOTTAWA RIVER PKYOTTAWA RIVER PKYOTTAWA RIVER PKYHERON RDHERON RDHERON RDHERON RD

HERON RDHERON RDHERON RDHERON RDHERON RDRO

GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR
RO
GER
ST
EVE
NS
DR

HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416HIGHWAY 416RO

GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR

CARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVEMA

RC
H
RD
MA
RC
H
RD
MA
RC
H
RD
MA
RC
H
RD
MA
RC
H
RD
MA
RC
H
RD
MA
RC
H
RD
MA
RC
H
RD
MA
RC
H
RD
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D
FA
LL
OW
FIE
LD
R
D

RICHMOND RDRICHMOND RDRICHMOND RDRICHMOND RDRICHMOND RDRICHMOND RDRICHMOND RDRICHMOND RDRICHMOND RDW

ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD
W
ES
T
HU
NT
C
LU
B
RD

CARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVERO

G
E R
S
T E
V E
N
S
D R
RO
G
E R
S
T E
V E
N
S
D R
RO
G
E R
S
T E
V E
N
S
D R
R O
G
E R
S
T E
V E
N
S
D R
RO
G
E R
S
T E
V E
N
S
D R
R O
G
E R
S
T E
V E
N
S
D R
RO
G
E R
S
T E
V E
N
S
D R
RO
G
E R
S
T E
V E
N
S
D R
RO
G
E R
S
T E
V E
N
S
D R
W
IL
SO
N
RD
W
IL
SO
N
RD
W
IL
SO
N
RD
W
IL
SO
N
RD
W
IL
SO
N
RD
W
IL
SO
N
RD
W
IL
SO
N
RD
W
IL
SO
N
RD
W
IL
SO
N
RD

DUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDDUNROBIN RDMARCH RDMARCH RDMARCH RDMARCH RDMARCH RDMARCH RDMARCH RDMARCH RDMARCH RDRICHMO

ND RDRICHMO

ND RDRICHMO

ND RDRICHMO

ND RDRICHMO

ND RDRICHMO

ND RDRICHMO

ND RDRICHMO

ND RDRICHMO

ND RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDRIC

HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D
RIC
HM
ON
D R
D

PINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDSTRANDHERD DRSTRANDHERD DRSTRANDHERD DRSTRANDHERD DRSTRANDHERD DRSTRANDHERD DRSTRANDHERD DRSTRANDHERD DRSTRANDHERD DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRM

OODIE DRFA

LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
FA
LL
OW
FIE
LD
RD
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D
DU
NRO
B
IN
R
D

EAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDEAGLESON RDRI

CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
RI
CH
M
O
ND
R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D
MA
RC
H R
D

FRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDFRANKTOWN RDDW

YE
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D
DW
Y E
R
H I
LL
R
D

DWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDCARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECARLING AVECA

RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E
CA
RLI
NG
AV
E

DWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDWYER HILL RDDW

YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
DW
YE
R
HI
LL
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
G
RA
ND
VI
EW
R
D
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16
H I
GH
W
AY
4
16

CEDARVIEW RD

CEDARVIEW RD

CEDARVIEW RD

CEDARVIEW RD

CEDARVIEW RD

CEDARVIEW RD

CEDARVIEW RD

CEDARVIEW RD

CEDARVIEW RD

HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
HI
G
HW
AY
4
16
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
OT
TA
W
A
RI
VE
R
PK
Y
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
RO
GE
R S
TE
VE
NS
DR
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
HIG
HW
AY
7
RI
VE
R
R D
RI
VE
R
R D
RI
VE
R
R D
RI
VE
R
R D
RI
VE
R
R D
RI
VE
R
R D
RI
VE
R
R D
RI
VE
R
R D
RI
VE
R
R D

COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64FOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFO

YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D

COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64FO

YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D
FO
YM
OU
NT
R
D

FOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOYMOUNT RDFOY

MOU

NT RD

FOY
MOU

NT RD

FOY
MOU

NT RD

FOY
MOU

NT RD

FOY
MOU

NT RD

FOY
MOU

NT RD

FOY
MOU

NT RD

FOY
MOU

NT RD

FOY
MOU

NT RD

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

ALICE STALICE STALICE STALICE STALICE STALICE STALICE STALICE STALICE STHIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41M

OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
M
OU
NT
AI
N
RD
CO

UNTY RD 9CO

UNTY RD 9CO

UNTY RD 9CO

UNTY RD 9CO

UNTY RD 9CO

UNTY RD 9CO

UNTY RD 9CO

UNTY RD 9CO

UNTY RD 9HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64COUNTY RD 64HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41MO

UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD

MICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDHIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17WESTMEATH RDWESTMEATH RDWESTMEATH RDWESTMEATH RDWESTMEATH RDWESTMEATH RDWESTMEATH RDWESTMEATH RDWESTMEATH RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDCOUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9COUNTY RD 9MICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDMICKSBURG RDHIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60CO

UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17BEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDCOUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50W

ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D
W
ES
TM
EA
TH
R
D

COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50GRATTAN RDGRATTAN RDGRATTAN RDGRATTAN RDGRATTAN RDGRATTAN RDGRATTAN RDGRATTAN RDGRATTAN RDHYN

DFO

RD RD

HYN
DFO

RD RD

HYN
DFO

RD RD

HYN
DFO

RD RD

HYN
DFO

RD RD

HYN
DFO

RD RD

HYN
DFO

RD RD

HYN
DFO

RD RD

HYN
DFO

RD RD

HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY

132HIGHWAY 132

HIGHWAY 132

HIGHWAY 132HIGHWAY 132

HIGHWAY 132HIGHWAY 132

HIGHWAY 132

HIGHWAY 132HIGHWAY 132

HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HY

ND
FO
RD
RD
HY
ND
FO
RD
RD
HY
ND
FO
RD
RD
HY
ND
FO
RD
RD
HY
ND
FO
RD
RD
HY
ND
FO
RD
RD
HY
ND
FO
RD
RD
HY
ND
FO
RD
RD
HY
ND
FO
RD
RD

HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60CO

UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8
CO
UN
TY
RD
8

KENNELLY RDKENNELLY RDKENNELLY RDKENNELLY RDKENNELLY RDKENNELLY RDKENNELLY RDKENNELLY RDKENNELLY RDHIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17STONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTONE RDSTO

NE
RD
STO
NE
RD
STO
NE
RD
STO
NE
RD
STO
NE
RD
STO
NE
RD
STO
NE
RD
STO
NE
RD
STO
NE
RD
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
HIG
HW
AY
13
2
LO
OKO

UT RDLO

OKO

UT RDLO

OKO

UT RDLO

OKO

UT RDLO

OKO

UT RDLO

OKO

UT RDLO

OKO

UT RDLO

OKO

UT RDLO

OKO

UT RDW

ES
T M
E A
T H
R
D
W
E S
T M
E A
T H
R
D
W
E S
T M
E A
T H
R
D
W
E S
T M
E A
T H
R
D
W
E S
T M
E A
T H
R
D
W
E S
T M
E A
T H
R
D
W
E S
T M
E A
T H
R
D
W
E S
T M
E A
T H
R
D
W
E S
T M
E A
T H
R

D COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50COUNTY RD 50HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60C

O
U N
TY
R
D
61
C
O
U N
TY
R
D
61
C
O
U N
TY
R
D
61
C
O
U N
TY
R
D
61
C
O
U N
TY
R
D
61
C
O
U N
TY
R
D
61
C
O
U N
TY
R
D
61
C
O
U N
TY
R
D
61
C
O
U N
TY
R
D
61

ANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINELA

P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D
LA
P
AS
SE
R
D

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17QUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINECHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCO

UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8
CO
UN
TY
R
D 4
8

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDHIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HI

GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2
HI
GH
W
AY
13
2

HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINEQUEENS LINECHE

NA
UX
RD
CHE
NA
UX
RD
CHE
NA
UX
RD
CHE
NA
UX
RD
CHE
NA
UX
RD
CHE
NA
UX
RD
CHE
NA
UX
RD
CHE
NA
UX
RD
CHE
NA
UX
RD

CHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCHENAUX RDCOUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52CA

STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D
CA
STL
EF
OR
D R
D

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDCOUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDCOUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 6COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52ANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDANDERSON RDCOUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52COUNTY RD 52RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDW

HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD
W
HI
TE
L
AK
E
RD

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDFLAT RAPIDS RDFLAT RAPIDS RDFLAT RAPIDS RDFLAT RAPIDS RDFLAT RAPIDS RDFLAT RAPIDS RDFLAT RAPIDS RDFLAT RAPIDS RDFLAT RAPIDS RDCO

UN
TY
RD
54
CO
UN
TY
RD
54
CO
UN
TY
RD
54
CO
UN
TY
RD
54
CO
UN
TY
RD
54
CO
UN
TY
RD
54
CO
UN
TY
RD
54
CO
UN
TY
RD
54
CO
UN
TY
RD
54

COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23COUNTY RD 23WHIT

E L
AK
E R
D
WH
ITE
LA
KE
RD
WH
ITE
LA
KE
RD
WH
ITE
LA
KE
RD
WH
ITE
LA
KE
RD
WH
ITE
LA
KE
RD
WH
ITE
LA
KE
RD
WH
ITE
LA
KE
RD
WH
ITE
LA
KE
RD

COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3 COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3COUNTY RD 3RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDWH

ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD
WH
ITE
W
AT
ER
RD

HIGHWAY

148HIGHWAY

148HIGHWAY

148HIGHWAY

148HIGHWAY

148HIGHWAY

148HIGHWAY

148HIGHWAY

148HIGHWAY

148BEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDBEACHBURG RDCOUNTY RD 55COUNTY RD 55COUNTY RD 55COUNTY RD 55COUNTY RD 55COUNTY RD 55COUNTY RD 55COUNTY RD 55COUNTY RD 55PEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WPEMBROKE ST WHIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17PETAWAWA BLVDPETAWAWA BLVDPETAWAWA BLVDPETAWAWA BLVDPETAWAWA BLVDPETAWAWA BLVDPETAWAWA BLVDPETAWAWA BLVDPETAWAWA BLVDTV TOWER RDTV TOWER RDTV TOWER RDTV TOWER RDTV TOWER RDTV TOWER RDTV TOWER RDTV TOWER RDTV TOWER RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDMUD LAKE RDGREENWOOD RDGREENWOOD RDGREENWOOD RDGREENWOOD RDGREENWOOD RDGREENWOOD RDGREENWOOD RDGREENWOOD RDGREENWOOD RDHI

G
HW
A Y
1
7
HI
G
HW
A Y
1
7
HI
G
HW
A Y
1
7
HI
G
HW
A Y
1
7
HI
G
HW
A Y
1
7
HI
G
HW
A Y
1
7
HI
G
HW
A Y
1
7
HI
G
HW
A Y
1
7
HI
G
HW
A Y
1
7

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17DORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDDORAN RDBA

RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
BA
RO
N
CA
NY
ON
R
D
HIG
H W

A Y 41HI GH W

A Y 41HI GH W

A Y 41HI GH W

A Y 41HI GH W

A Y 41HI GH W

A Y 41HI GH W

A Y 41HI GH W

A Y 41HI GH W

A Y 41HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17

HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17 HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIG

HW

AY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIG

HWA

Y 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41HIG

HW

AY 41ROUND LAKE RD

ROUND LAKE RD

ROUND LAKE RD

ROUND LAKE RD

ROUND LAKE RD

ROUND LAKE RD

ROUND LAKE RD

ROUND LAKE RD

ROUND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

ROU

ND LAKE RD

RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AK
E R
D
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
RO
UN
D L
AKE
RD
COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 30

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

COU

NTY RD 56

HIG
HW
A

Y 4 1H IGHW

A

Y 4 1H IGHW

A

Y 4 1H IGHW

A

Y 4 1H IGHW

A

Y 4 1H IGHW

A

Y 4 1H IGHW

A

Y 4 1H IGHW

A

Y 4 1H IGHW

A

Y 4 1H

IG
H
W
A
Y
41
H
IG
H
W
A
Y
41
H
IG
H
W
A
Y
41
H
IG
H
W
A
Y
41
H
IG
H
W
A
Y
41
H
IG
H
W
A
Y
41
H
IG
H
W
A
Y
41
H
IG
H
W
A
Y
41
H
IG
H
W
A
Y
41

HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28TRAIL RDTRAIL RDTRAIL RDTRAIL RDTRAIL RDTRAIL RDTRAIL RDTRAIL RDTRAIL RDCO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648CO

UNTY RD 648HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HI

GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1
HI
GH
W
AY
4
1

HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIGHWAY 41HIG

H
W

AY 41HIG

H
W

AY 41HIG

H
W

AY 41HIG

H
W

AY 41HIG

H
W

AY 41HIG

H
W

AY 41HIG

H
W

AY 41HIG

H
W

AY 41HIG

H
W

AY 41HI

GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1
HI
GH
WA
Y 4
1

HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511HIGHWAY 511AP

PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D
AP
PL
ET
O
N
SI
DE
R
D

HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIGHWAY 60HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523HIG

HW

AY 523CO

UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09
CO
UNT
Y R
D 5
09

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY

60

HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28HIGHWAY 28COUNTY RD 648COUNTY RD 648COUNTY RD 648COUNTY RD 648COUNTY RD 648COUNTY RD 648COUNTY RD 648COUNTY RD 648COUNTY RD 648HI

GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HI
GH
WA
Y 2
8
HIG
HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIG

HW

AY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 127HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17USBORNE STUSBORNE STUSBORNE STUSBORNE STUSBORNE STUSBORNE STUSBORNE STUSBORNE STUSBORNE STHIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17HIGHWAY 17CO

UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43
CO
UN
TY
RD
43

MAZARI CRTMAZARI CRTMAZARI CRTMAZARI CRTMAZARI CRTMAZARI CRTMAZARI CRTMAZARI CRTMAZARI CRTWINDSWEPT PVTWINDSWEPT PVTWINDSWEPT PVTWINDSWEPT PVTWINDSWEPT PVTWINDSWEPT PVTWINDSWEPT PVTWINDSWEPT PVTWINDSWEPT PVTBR

AD
Y A
VE
BR
AD
Y A
VE
BR
AD
Y A
VE
BR
AD
Y A
VE
BR
AD
Y A
VE
BR
AD
Y A
VE
BR
AD
Y A
VE
BR
AD
Y A
VE
BR
AD
Y A
VE
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT
BRA
DBU
RY
CRT

GENTRY RDGENTRY RDGENTRY RDGENTRY RDGENTRY RDGENTRY RDGENTRY RDGENTRY RDGENTRY RDEVE

NW
OO
D P
VT
EVE
NW
OO
D P
VT
EVE
NW
OO
D P
VT
EVE
NW
OO
D P
VT
EVE
NW
OO
D P
VT
EVE
NW
OO
D P
VT
EVE
NW
OO
D P
VT
EVE
NW
OO
D P
VT
EVE
NW
OO
D P
VT
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
TA
LL
TR
EE
CR
ES
RUS

S BROWN

RD
RUS

S BROWN

RD
RUS

S BROWN

RD
RUS

S BROWN

RD
RUS

S BROWN

RD
RUS

S BROWN

RD
RUS

S BROWN

RD
RUS

S BROWN

RD
RUS

S BROWN

RD

SCHONAUER RDSCHONAUER RDSCHONAUER RDSCHONAUER RDSCHONAUER RDSCHONAUER RDSCHONAUER RDSCHONAUER RDSCHONAUER RDMATAWATCHAN RDMATAWATCHAN RDMATAWATCHAN RDMATAWATCHAN RDMATAWATCHAN RDMATAWATCHAN RDMATAWATCHAN RDMATAWATCHAN RDMATAWATCHAN RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RD

BUCKSHOT LAKE RD

BUCKSHOT LAKE RD

BUCKSHOT LAKE RD

BUCKSHOT LAKE RD

BUCKSHOT LAKE RD

BUCKSHOT LAKE RD

BUCKSHOT LAKE RD

BUCKSHOT LAKE RD

SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
SO
UT
H
BU
SH
R
D
MUD

LAKE RDMUD

LAKE RDMUD

LAKE RDMUD

LAKE RDMUD

LAKE RDMUD

LAKE RDMUD

LAKE RDMUD

LAKE RDMUD

LAKE RDFA

RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE
FA
RM
G
AT
E
LA
NE

SHINSHINSHI

SHINSHI

SHINSHINSHI

SHINCAN

ONT
O R
D
CAN
ONT
O R
D
CAN
ONT
O R
D
CAN
ONT
O R
D
CAN
ONT
O R
D
CAN
ONT
O R
D
CAN
ONT
O R
D
CAN
ONT
O R
D
CAN
ONT
O R
D

LE WIS DRLE WIS DRLE WIS DRLE WIS DRLE WIS DRLE WIS DRLE WIS DRLE WIS DRLE WIS DRBOL

TON

POINT TRAILBOL

TON

POINT TRAILBOL

TON

POINT TRAILBOL

TON

POINT TRAILBOL

TON

POINT TRAILBOL

TON

POINT TRAILBOL

TON

POINT TRAILBOL

TON

POINT TRAILBOL

TON

POINT TRAILSPRUCE ST

SPRUCE ST

SPRUCE STSPRUCE ST

SPRUCE STSPRUCE ST

SPRUCE ST

SPRUCE STSPRUCE ST

RO

CK LAKE RDRO

CK LAKE RDRO

CK LAKE RDRO

CK LAKE RDRO

CK LAKE RDRO

CK LAKE RDRO

CK LAKE RDRO

CK LAKE RDRO

CK LAKE RDCK LAKE RDCK LAKE RDCK LAKE RDCK LAKE RDCK LAKE RDCK LAKE RDCK LAKE RDCK LAKE RDCK LAKE RDCO

TT
D
R
CO
TT
D
R
CO
TT
D
R
MC
OT
T
DR
MC
OT
T
DR
MC
OT
T
DR
MC
OT
T
DR
MC
OT
T
DR
MC
OT
T
DR
PET
ERS
ON
RD
PET
ERS
ON
RD
PET
ERS
ON
RD
PET
ERS
ON
RD
PET
ERS
ON
RD
PET
ERS
ON
RD
PET
ERS
ON
RD
PET
ERS
ON
RD
PET
ERS
ON
RD
M

CGARRY RDM

CGARRY RDM

CGARRY RDM

CGARRY RDM

CGARRY RDM

CGARRY RDM

CGARRY RDM

CGARRY RDM

CGARRY RDBRETHOUR RDBRETHOUR RDBRETHOUR RDBRETHOUR RDBRETHOUR RDBRETHOUR RDBRETHOUR RDBRETHOUR RDBRETHOUR RDAIRPORT RD

AIRPORT RD

AIRPORT RD

AIRPORT RD

AIRPORT RD

AIRPORT RD

AIRPORT RD

AIRPORT RD

AIRPORT RD

N
O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDN

O

R TH B

AP TISTE L AKE RDCANNON LANECANNON LANECANNON LANECANNON LANECANNON LANECANNON LANECANNON LANECANNON LANECANNON LANEMA

DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
MA
DA
W
AS
KA
R
D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
ST
E E
LE
S
R D
M

CALP INE RDM

CALP INE RDM

CALP INE RDM

CALP INE RDM

CALP INE RDM

CALP INE RDM

CALP INE RDM

CALP INE RDM

CALP INE RDM

O

X A M RD

M
O

X A M RD

M
O

X A M RD

M
O

X A M RD

M
O

X A M RD

M
O

X A M RD

M
O

X A M RD

M
O

X A M RD

M
O

X A M RD

BOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDROBINSON RDROBINSON RDROBINSON RDROBINSON RDROBINSON RDROBINSON RDROBINSON RDROBINSON RDROBINSON RDGRAPHITE LANEGRAPHITE LANEGRAPHITE LANEGRAPHITE LANEGRAPHITE LANEGRAPHITE LANEGRAPHITE LANEGRAPHITE LANEGRAPHITE LANEGRAPHITE RD

GRAPHITE RD

GRAPHITE RD

GRAPHITE RD

GRAPHITE RD

GRAPHITE RD

GRAPHITE RD

GRAPHITE RD

GRAPHITE RD

CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD
CR
OS
S
CO
UN
TR
Y
RD

MUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDMUSCLOW GREENVIEW RDM

O
O
NE
Y
RD
M
O
O
NE
Y
RD
M
O
O
NE
Y
RD
M
O
O
NE
Y
RD
M
O
O
NE
Y
RD
M
O
O
NE
Y
RD
M
O
O
NE
Y
RD
M
O
O
NE
Y
RD
M
O
O
NE
Y
RD

GRAPHITE RDGRAPHITE RDGRAPHITE RDGRAPHITE RDGRAPHITE RDGRAPHITE RDGRAPHITE RDGRAPHITE RDGRAPHITE RDHY

BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD

MCCORMICK RDMCCORMICK RDMCCORMICK RDMCCORMICK RDMCCORMICK RDMCCORMICK RDMCCORMICK RDMCCORMICK RDMCCORMICK RDBRO

NSO
N R
D
BRO
NSO
N R
D
BRO
NSO
N R
D
BRO
NSO
N R
D
BRO
NSO
N R
D
BRO
NSO
N R
D
BRO
NSO
N R
D
BRO
NSO
N R
D
BRO
NSO
N R
D
WEL

SH RD

WEL

SH RD

WEL

SH RD

WEL

SH RD

WEL

SH RD

WEL

SH RD

WEL

SH RD

WEL

SH RD

WEL

SH RD

HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
HY
BL
A
RD
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D
M
US
CL
OW
G
RE
EN
VI
EW
R
D

CARR RDCARR RDCARR RDCARR RDCARR RDCARR RDCARR RDCARR RDCARR RDHOL

LAND LAKE RDHOL

LAND LAKE RDHOL

LAND LAKE RDHOL

LAND LAKE RDHOL

LAND LAKE RDHOL

LAND LAKE RDHOL

LAND LAKE RDHOL

LAND LAKE RDHOL

LAND LAKE RDALLISON LANEALLISON LANEALLISON LANEALLISON LANEALLISON LANEALLISON LANEALLISON LANEALLISON LANEALLISON LANENEW

CARLOW

RD
NEW

CARLOW

RD
NEW

CARLOW

RD
NEW

CARLOW

RD
NEW

CARLOW

RD
NEW

CARLOW

RD
NEW

CARLOW

RD
NEW

CARLOW

RD
NEW

CARLOW

RD
BAR
TLE

TT RD

BAR
TLE

TT RD

BAR
TLE

TT RD

BAR
TLE

TT RD

BAR
TLE

TT RD

BAR
TLE

TT RD

BAR
TLE

TT RD

BAR
TLE

TT RD

BAR
TLE

TT RD

LOWER FARADAY RDLOWER FARADAY RDLOWER FARADAY RDLOWER FARADAY RDLOWER FARADAY RDLOWER FARADAY RDLOWER FARADAY RDLOWER FARADAY RDLOWER FARADAY RD CAMERON RD

CAMERON RD

CAMERON RD

CAMERON RD

CAMERON RD

CAMERON RD

CAMERON RD

CAMERON RD

CAMERON RD

IEKEL RDIEKEL RDIEKEL RDIEKEL RDIEKEL RDIEKEL RDIEKEL RDIEKEL RDIEKEL RDJE

FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D
JE
FF
RE
Y L
AK
E R
D

LEVERIDGE RD

LEVERIDGE RD

LEVERIDGE RD

LEVERIDGE RD

LEVERIDGE RD

LEVERIDGE RD

LEVERIDGE RD

LEVERIDGE RD

LEVERIDGE RD

CAM

ERON RDCAM

ERON RDCAM

ERON RDCAM

ERON RDCAM

ERON RDCAM

ERON RDCAM

ERON RDCAM

ERON RDCAM

ERON RDWE

ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
WE
ST
MU
LLE
T L
AK
E D
R
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
LA
KE
VIE
W
RD
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
PA
PIN
EA
U L
AK
E R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
N
EW
C
AR
L O
W
R
D
SI
BE
RI
A
RD
SI
BE
RI
A
RD
SI
BE
RI
A
RD
SI
BE
RI
A
RD
SI
BE
RI
A
RD
SI
BE
RI
A
RD
SI
BE
RI
A
RD
SI
BE
RI
A
RD
SI
BE
RI
A
RD

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RD RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDBUR

GES
S R
D
BUR
GES
S R
D
BUR
GES
S R
D
BUR
GES
S R
D
BUR
GES
S R
D
BUR
GES
S R
D
BUR
GES
S R
D
BUR
GES
S R
D
BUR
GES
S R
D

ALEXANDER LANEALEXANDER LANEALEXANDER LANEALEXANDER LANEALEXANDER LANEALEXANDER LANEALEXANDER LANEALEXANDER LANEALEXANDER LANEBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBESSEMER RDBESSEMER RDBESSEMER RDBESSEMER RDBESSEMER RDBESSEMER RDBESSEMER RDBESSEMER RDBESSEMER RDMATHER RDMATHER RDMATHER RDMATHER RDMATHER RDMATHER RDMATHER RDMATHER RDMATHER RDTROLLEY RD

TROLLEY RD

TROLLEY RD

TROLLEY RD

TROLLEY RD

TROLLEY RD

TROLLEY RD

TROLLEY RD

TROLLEY RD

BO

ULTER RDBO

ULTER RDBO

ULTER RDBO

ULTER RDBO

ULTER RDBO

ULTER RDBO

ULTER RDBO

ULTER RDBO

ULTER RDH AV ER GA L RDH AV ER GA L RDH AV ER GA L RDH AV ER GA L RDH AV ER GA L RDH AV ER GA L RDH AV ER GA L RDH AV ER GA L RDH AV ER GA L RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDPINECREST RDM

AYO LAKE RDM

AYO LAKE RDM

AYO LAKE RDM

AYO LAKE RDM

AYO LAKE RDM

AYO LAKE RDM

AYO LAKE RDM

AYO LAKE RDM

AYO LAKE RDTOWER RDTOWER RDTOWER RDTOWER RDTOWER RDTOWER RDTOWER RDTOWER RDTOWER RDLAVALLE PLLAVALLE PLLAVALLE PLLAVALLE PLLAVALLE PLLAVALLE PLLAVALLE PLLAVALLE PLLAVALLE PLUM

FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D
UM
FR
AV
ILL
E R
D

BEAR SHANTY LANEBEAR SHANTY LANEBEAR SHANTY LANEBEAR SHANTY LANEBEAR SHANTY LANEBEAR SHANTY LANEBEAR SHANTY LANEBEAR SHANTY LANEBEAR SHANTY LANEOLD

OLD
OLD
OLD
OLD
OLD
OLD
OLD
OLD
DE
TLO
R R
D
DE
TLO
R R
D
DE
TLO
R R
D
DE
TLO
R R
D
DE
TLO
R R
D
DE
TLO
R R
D
DE
TLO
R R
D
DE
TLO
R R
D
DE
TLO
R R
D

MALLOY RDMALLOY RDMALLOY RDMALLOY RDMALLOY RDMALLOY RDMALLOY RDMALLOY RDMALLOY RDCRAWFORD RDCRAWFORD RDCRAWFORD RDCRAWFORD RDCRAWFORD RDCRAWFORD RDCRAWFORD RDCRAWFORD RDCRAWFORD RDSTA

NGL

LANE

STA
NGL

LANE

STA
NGL

LANE

STA
NGL

LANE

STA
NGL

LANE

STA
NGL

LANE

STA
NGL

LANE

STA
NGL

LANE

STA
NGL

LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

M

A CKENZI E LANE

UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
UP
PE
R T
UR
RIF
F R
D
SW
O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSW

O

RDFINGAL LAKE TR AILSTANGL LANESTANGL LANESTANGL LANESTANGL LANESTANGL LANESTANGL LANESTANGL LANESTANGL LANESTANGL LANEST

AN
GL
LA
NE
ST
AN
GL
LA
NE
ST
AN
GL
LA
NE
ST
AN
GL
LA
NE
ST
AN
GL
LA
NE
ST
AN
GL
LA
NE
ST
AN
GL
LA
NE
ST
AN
GL
LA
NE
ST
AN
GL
LA
NE

BESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEM

ACKENZIE LANEM

ACKENZIE LANEM

ACKENZIE LANEM

ACKENZIE LANEM

ACKENZIE LANEM

ACKENZIE LANEM

ACKENZIE LANEM

ACKENZIE LANEM

ACKENZIE LANEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEM

A CKEN ZIE LA NEMAC

KE
NZ
IE
LA
NE
MA
CK
EN
ZIE
LA
NE
MA
CK
EN
ZIE
LA
NE
MA
CK
EN
ZIE
LA
NE
MA
CK
EN
ZIE
LA
NE
MA
CK
EN
ZIE
LA
NE
MA
CK
EN
ZIE
LA
NE
MA
CK
EN
ZIE
LA
NE
MA
CK
EN
ZIE
LA
NE

SPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILV LAKE TRAILV LAKE TRAILV LAKE TRAILV LAKE TRAILV LAKE TRAILV LAKE TRAILV LAKE TRAILV LAKE TRAILV LAKE TRAILCROSS TRAILCROSS TRAILCROSS TRAILCROSS TRAILCROSS TRAILCROSS TRAILCROSS TRAILCROSS TRAILCROSS TRAILM

A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
M
A
CK
EN
ZI
E
LA
N E
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
EG
AN
LA
KE
TR
AIL
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD
BIR
CH
LA
KE
RD

GRANT LANEGRANT LANEGRANT LANEGRANT LANEGRANT LANEGRANT LANEGRANT LANEGRANT LANEGRANT LANEGRASSY LAKE TRAILGRASSY LAKE TRAILGRASSY LAKE TRAILGRASSY LAKE TRAILGRASSY LAKE TRAILGRASSY LAKE TRAILGRASSY LAKE TRAILGRASSY LAKE TRAILGRASSY LAKE TRAILQUIRKS RDQUIRKS RDQUIRKS RDQUIRKS RDQUIRKS RDQUIRKS RDQUIRKS RDQUIRKS RDQUIRKS RDLA

KE
R
D
LA
KE
R
D
LA
KE
R
D
LA
KE
R
D
LA
KE
R
D
LA
KE
R
D
LA
KE
R
D
LA
KE
R
D
LA
KE
R
D
M
CC
AW
R
D
M
CC
AW
R
D
M
CC
AW
R
D
M
CC
AW
R
D
M
CC
AW
R
D
M
CC
AW
R
D
M
CC
AW
R
D
M
CC
AW
R
D
M
CC
AW
R
D

CASHEL TRAILCASHEL TRAILCASHEL TRAILCASHEL TRAILCASHEL TRAILCASHEL TRAILCASHEL TRAILCASHEL TRAILCASHEL TRAILHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDFRASER LAKE LANEFRASER LAKE LANEFRASER LAKE LANEFRASER LAKE LANEFRASER LAKE LANEFRASER LAKE LANEFRASER LAKE LANEFRASER LAKE LANEFRASER LAKE LANEM

AYO

LAKE RDM

AYO

LAKE RDM

AYO

LAKE RDM

AYO

LAKE RDM

AYO

LAKE RDM

AYO

LAKE RDM

AYO

LAKE RDM

AYO

LAKE RDM

AYO

LAKE RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDBOULTER RDCE

M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
CE
M
ET
ER
Y
RD
W

INDY POINT RDW

INDY POINT RDW

INDY POINT RDW

INDY POINT RDW

INDY POINT RDW

INDY POINT RDW

INDY POINT RDW

INDY POINT RDW

INDY POINT RDMACPHERSON RD

MACPHERSON RD

MACPHERSON RD

MACPHERSON RD

MACPHERSON RD

MACPHERSON RD

MACPHERSON RD

MACPHERSON RD

MACPHERSON RD

LAROCQUE RDLAROCQUE RDLAROCQUE RDLAROCQUE RDLAROCQUE RDLAROCQUE RDLAROCQUE RDLAROCQUE RDLAROCQUE RDMITCHELL RDMITCHELL RDMITCHELL RDMITCHELL RDMITCHELL RDMITCHELL RDMITCHELL RDMITCHELL RDMITCHELL RD2 L

IN
E
2 L
IN
E
2 L
IN
E
2 L
IN
E
2 L
IN
E
2 L
IN
E
2 L
IN
E
2 L
IN
E
2 L
IN
E

CEDARDALE RDCEDARDALE RDCEDARDALE RDCEDARDALE RDCEDARDALE RDCEDARDALE RDCEDARDALE RDCEDARDALE RDCEDARDALE RDCONCESSION RD 8CCONCESSION RD 8CCONCESSION RD 8CCONCESSION RD 8CCONCESSION RD 8CCONCESSION RD 8CCONCESSION RD 8CCONCESSION RD 8CCONCESSION RD 8CGO

LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D
GO
LD
CR
EE
K R
D

6 LINE6 LINE6 LINE6 LINE6 LINE6 LINE6 LINE6 LINE6 LINEPI

CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD
PI
CK
ER
AL
P
O
IN
T
RD

3 AVE

3 AVE

3 AVE3 AVE

3 AVE3 AVE

3 AVE

3 AVE3 AVE

BOYD STBOYD STBOYD STBOYD STBOYD STBOYD STBOYD STBOYD STBOYD STMA

CP
HA
ILS
RD
MA
CP
HA
ILS
RD
MA
CP
HA
ILS
RD
MA
CP
HA
ILS
RD
MA
CP
HA
ILS
RD
MA
CP
HA
ILS
RD
MA
CP
HA
ILS
RD
MA
CP
HA
ILS
RD
MA
CP
HA
ILS
RD
H

ILL VIEW R

D
H

ILL VIEW R

D
H

ILL VIEW R

D
H

ILL VIEW R

D
H

ILL VIEW R

D
H

ILL VIEW R

D
H

ILL VIEW R

D
H

ILL VIEW R

D
H

ILL VIEW R

D

GILROY RDGILROY RDGILROY RDGILROY RDGILROY RDGILROY RDGILROY RDGILROY RDGILROY RDLAVANT DARLING RDLAVANT DARLING RDLAVANT DARLING RDLAVANT DARLING RDLAVANT DARLING RDLAVANT DARLING RDLAVANT DARLING RDLAVANT DARLING RDLAVANT DARLING RDFL

EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
FL
EW
EL
LY
N R
D
CL
AY
ST
CL
AY
ST
CL
AY
ST
CL
AY
ST
CL
AY
ST
CL
AY
ST
CL
AY
ST
CL
AY
ST
CL
AY
ST

CARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RDCARROLL RD BURCHILL RDBURCHILL RDBURCHILL RDBURCHILL RDBURCHILL RDBURCHILL RDBURCHILL RDBURCHILL RDBURCHILL RDCO

LEM
AN
ST
CO
LEM
AN
ST
CO
LEM
AN
ST
CO
LEM
AN
ST
CO
LEM
AN
ST
CO
LEM
AN
ST
CO
LEM
AN
ST
CO
LEM
AN
ST
CO
LEM
AN
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
EM
ER
ICH
ST
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
PA
NM
UR
E R
D
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD
OL
D P
ER
TH
RD

DUNHAM STDUNHAM STDUNHAM STDUNHAM STDUNHAM STDUNHAM STDUNHAM STDUNHAM STDUNHAM STCONCESSION RD 8CONCESSION RD 8CONCESSION RD 8CONCESSION RD 8CONCESSION RD 8CONCESSION RD 8CONCESSION RD 8CONCESSION RD 8CONCESSION RD 8LA

VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D
LA
VA
NT
M
IL
L
R
D

BURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDRA

E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D
RA
E R
D

ASHTON STATION RDASHTON STATION RDASHTON STATION RDASHTON STATION RDASHTON STATION RDASHTON STATION RDASHTON STATION RDASHTON STATION RDASHTON STATION RDCO

NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B

RDRDRD RD

RD RD

RDRDRD

SHERIDAN RAPIDS RDSHERIDAN RAPIDS RDSHERIDAN RAPIDS RDSHERIDAN RAPIDS RDSHERIDAN RAPIDS RDSHERIDAN RAPIDS RDSHERIDAN RAPIDS RDSHERIDAN RAPIDS RDSHERIDAN RAPIDS RDHO

DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
HO
DD
INO
TT
LA
NE
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
PR
E S
TO
NV
A L
E
RD
CON
CES

SION RD 4D

CON
CES

SION RD 4D

CON
CES

SION RD 4D

CON
CES

SION RD 4D

CON
CES

SION RD 4D

CON
CES

SION RD 4D

CON
CES

SION RD 4D

CON
CES

SION RD 4D

CON
CES

SION RD 4D

CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2DA

RL
IN
G
R
D
DA
RL
IN
G
R
D
DA
RL
IN
G
R
D
DA
RL
IN
G
R
D
DA
RL
IN
G
R
D
DA
RL
IN
G
R
D
DA
RL
IN
G
R
D
DA
RL
IN
G
R
D
DA
RL
IN
G
R
D

KEITHS BLUFFKEITHS BLUFFKEITHS BLUFFKEITHS BLUFFKEITHS BLUFFKEITHS BLUFFKEITHS BLUFFKEITHS BLUFFKEITHS BLUFFSNYE RDSNYE RDSNYE RDSNYE RDSNYE RDSNYE RDSNYE RDSNYE RDSNYE RDCONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2DOBBIE RDDOBBIE RDDOBBIE RDDOBBIE RDDOBBIE RDDOBBIE RDDOBBIE RDDOBBIE RDDOBBIE RD2

LI
NE
2
LI
NE
2
LI
NE
2
LI
NE
2
LI
NE
2
LI
NE
2
LI
NE
2
LI
NE
2
LI
NE

GALBRAITH RDGALBRAITH RDGALBRAITH RDGALBRAITH RDGALBRAITH RDGALBRAITH RDGALBRAITH RDGALBRAITH RDGALBRAITH RD12 LINE12 LINE12 LINE12 LINE12 LINE12 LINE12 LINE12 LINE12 LINECONCESSION RD 10BCONCESSION RD 10BCONCESSION RD 10BCONCESSION RD 10BCONCESSION RD 10BCONCESSION RD 10BCONCESSION RD 10BCONCESSION RD 10BCONCESSION RD 10BOL

D P
ER
TH
R
D
OL
D P
ER
TH
R
D
OL
D P
ER
TH
R
D
OL
D P
ER
TH
R
D
OL
D P
ER
TH
R
D
OL
D P
ER
TH
R
D
OL
D P
ER
TH
R
D
OL
D P
ER
TH
R
D
OL
D P
ER
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
O
LD
P
E R
TH
R
D
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B
CO
N C
ES
SI
O
N
RD
7
B

MARY STMARY STMARY STMARY STMARY STMARY STMARY STMARY STMARY ST LINE

RD
9
LIN
E
RD
9
LIN
E
RD
9
LIN
E
RD
9
LIN
E
RD
9
LIN
E
RD
9
LIN
E
RD
9
LIN
E
RD
9
LIN
E
RD
9

BLACK CREEK RDBLACK CREEK RDBLACK CREEK RDBLACK CREEK RDBLACK CREEK RDBLACK CREEK RDBLACK CREEK RDBLACK CREEK RDBLACK CREEK RDCO

NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
CO
NC
ES
SI
O
N
RD
3
ON
EIL
L R
D
ON
EIL
L R
D
ON
EIL
L R
D
ON
EIL
L R
D
ON
EIL
L R
D
ON
EIL
L R
D
ON
EIL
L R
D
ON
EIL
L R
D
ON
EIL
L R
D
ON
E
ON
E
ON
EON
E
ON
EON
E
ON
E
ON
E
ON
E

ORNE ST ENE ST EE ST EORNE ST EE ST EORNE ST ENE ST EE ST ENE ST EHA

SK
INS
RD
HA
SK
INS
RD
HA
SK
INS
RD
HA
SK
INS
RD
HA
SK
INS
RD
HA
SK
INS
RD
HA
SK
INS
RD
HA
SK
INS
RD
HA
SK
INS
RD

BOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDCR

AIG
RD
CR
AIG
RD
CR
AIG
RD
CR
AIG
RD
CR
AIG
RD
CR
AIG
RD
CR
AIG
RD
CR
AIG
RD
CR
AIG
RD

BOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDBOLTON RDRDRDRDRD

RDR
D

RDRDRD

FO

REST RDFO

REST RDFO

REST RDFO

REST RDFO

REST RDFO

REST RDFO

REST RDFO

REST RDFO

REST RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDTOW

ER RDTOW

ER RDTOW

ER RDTOW

ER RDTOW

ER RDTOW

ER RDTOW

ER RDTOW

ER RDTOW

ER RDGLENFIELD RDGLENFIELD RDGLENFIELD RDGLENFIELD RDGLENFIELD RDGLENFIELD RDGLENFIELD RDGLENFIELD RDGLENFIELD RDM

AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D
M
AT
AW
AT
CH
AN
R
D

HARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDHARTSMERE RDAIDE R DA IDE R DA IDE R DA IDE R DA IDE R DA IDE R DA IDE R DA IDE R DA IDE R DCCESS RDSS RDDCCESS RDDCCESS RDSS RDDSS RDASHBY LAKE RDASHBY LAKE RDASHBY LAKE RDASHBY LAKE RDASHBY LAKE RDASHBY LAKE RDASHBY LAKE RDASHBY LAKE RDASHBY LAKE RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDSMI

TH
LAK
E R
D
SMI
TH
LAK
E R
D
SMI
TH
LAK
E R
D
SMI
TH
LAK
E R
D
SMI
TH
LAK
E R
D
SMI
TH
LAK
E R
D
SMI
TH
LAK
E R
D
SMI
TH
LAK
E R
D
SMI
TH
LAK
E R
D

PUMPKIN STPUMPKIN STPUMPKIN STPUMPKIN STPUMPKIN STPUMPKIN STPUMPKIN STPUMPKIN STPUMPKIN STCOPELAND LAKE RDCOPELAND LAKE RDCOPELAND LAKE RDCOPELAND LAKE RDCOPELAND LAKE RDCOPELAND LAKE RDCOPELAND LAKE RDCOPELAND LAKE RDCOPELAND LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDSTA NS RDSTA NS RDSTA NS RDSTA NS RDSTA NS RDSTA NS RDSTA NS RDSTA NS RDSTA NS RDNIC

HO
LS
ON
ST
NIC
HO
LS
ON
ST
NIC
HO
LS
ON
ST
NIC
HO
LS
ON
ST
NIC
HO
LS
ON
ST
NIC
HO
LS
ON
ST
NIC
HO
LS
ON
ST
NIC
HO
LS
ON
ST
NIC
HO
LS
ON
ST
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
LIL
LIE
SI
DE
RD
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
RA
B
BI
T
PA
TH
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D
OLD
QU
ARR
Y R
D

LANDMARK CRTLANDMARK CRTLANDMARK CRTLANDMARK CRTLANDMARK CRTLANDMARK CRTLANDMARK CRTLANDMARK CRTLANDMARK CRTMONTY DRMONTY DRMONTY DRMONTY DRMONTY DRMONTY DRMONTY DRMONTY DRMONTY DRIRO

NW
OO
D
CR
T
IRO
NW
OO
D
CR
T
IRO
NW
OO
D
CR
T
IRO
NW
OO
D
CR
T
IRO
NW
OO
D
CR
T
IRO
NW
OO
D
CR
T
IRO
NW
OO
D
CR
T
IRO
NW
OO
D
CR
T
IRO
NW
OO
D
CR
T

RACHELL WAYRACHELL WAYRACHELL WAYRACHELL WAYRACHELL WAYRACHELL WAYRACHELL WAYRACHELL WAYRACHELL WAYCA

RP
VI
EW
RD
CA
RP
VI
EW
RD
CA
RP
VI
EW
RD
CA
RP
VI
EW
RD
CA
RP
VI
EW
RD
CA
RP
VI
EW
RD
CA
RP
VI
EW
RD
CA
RP
VI
EW
RD
CA
RP
VI
EW
RD
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
RO
CK
Y
CR
EE
K
W
AY
PES
KET

T RDPES

KET

T RDPES

KET

T RDPES

KET

T RDPES

KET

T RDPES

KET

T RDPES

KET

T RDPES

KET

T RDPES

KET

T RDCRAIG LEA DRCRAIG LEA DRCRAIG LEA DRCRAIG LEA DRCRAIG LEA DRCRAIG LEA DRCRAIG LEA DRCRAIG LEA DRCRAIG LEA DRMO

HI
LL
C
RE
S
MO
HI
LL
C
RE
S
MO
HI
LL
C
RE
S
MO
HI
LL
C
RE
S
MO
HI
LL
C
RE
S
MO
HI
LL
C
RE
S
MO
HI
LL
C
RE
S
MO
HI
LL
C
RE
S
MO
HI
LL
C
RE
S
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES
AL
IS
SI
A
CR
ES

SPRUCE RIDGE RDSPRUCE RIDGE RDSPRUCE RIDGE RDSPRUCE RIDGE RDSPRUCE RIDGE RDSPRUCE RIDGE RDSPRUCE RIDGE RDSPRUCE RIDGE RDSPRUCE RIDGE RDSOL LANESOL LANESOL LANESOL LANESOL LANESOL LANESOL LANESOL LANESOL LANECR

AIG
SI
DE
RD
CR
AIG
SI
DE
RD
CR
AIG
SI
DE
RD
CR
AIG
SI
DE
RD
CR
AIG
SI
DE
RD
CR
AIG
SI
DE
RD
CR
AIG
SI
DE
RD
CR
AIG
SI
DE
RD
CR
AIG
SI
DE
RD

OLD ALMONTE RDOLD ALMONTE RDOLD ALMONTE RDOLD ALMONTE RDOLD ALMONTE RDOLD ALMONTE RDOLD ALMONTE RDOLD ALMONTE RDOLD ALMONTE RDOL

D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD
OL
D A
LM
ON
TE
RD

CORKERY RDCORKERY RDCORKERY RDCORKERY RDCORKERY RDCORKERY RDCORKERY RDCORKERY RDCORKERY RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDDOMINION SPRINGS DRDOMINION SPRINGS DRDOMINION SPRINGS DRDOMINION SPRINGS DRDOMINION SPRINGS DRDOMINION SPRINGS DRDOMINION SPRINGS DRDOMINION SPRINGS DRDOMINION SPRINGS DRFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDWOODKILTON RDWOODKILTON RDWOODKILTON RDWOODKILTON RDWOODKILTON RDWOODKILTON RDWOODKILTON RDWOODKILTON RDWOODKILTON RDKIL

MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD
KIL
MA
UR
S S
IDE
RD

TRANQUILITY LANETRANQUILITY LANETRANQUILITY LANETRANQUILITY LANETRANQUILITY LANETRANQUILITY LANETRANQUILITY LANETRANQUILITY LANETRANQUILITY LANENEWTON RDNEWTON RDNEWTON RDNEWTON RDNEWTON RDNEWTON RDNEWTON RDNEWTON RDNEWTON RDDEERWOOD DRDEERWOOD DRDEERWOOD DRDEERWOOD DRDEERWOOD DRDEERWOOD DRDEERWOOD DRDEERWOOD DRDEERWOOD DRCA

RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD
CA
RR
OL
L S
IDE
RD

BURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDBURNT LANDS RDMARCHURST RDMARCHURST RDMARCHURST RDMARCHURST RDMARCHURST RDMARCHURST RDMARCHURST RDMARCHURST RDMARCHURST RDLOGGERS WAYLOGGERS WAYLOGGERS WAYLOGGERS WAYLOGGERS WAYLOGGERS WAYLOGGERS WAYLOGGERS WAYLOGGERS WAYW

EST EEW

EST EEW

EST EW

EST EEW

EST EW

EST EEW

EST EEW

EST EW

EST EETU

RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL
TU
RZ
YN
SK
I T
RA
IL

TRADERS RDTRADERS RDTRADERS RDTRADERS RDTRADERS RDTRADERS RDTRADERS RDTRADERS RDTRADERS RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDKUB

ESHESKI RD

KUB

ESHESKI RD

KUB

ESHESKI RD

KUB

ESHESKI RD

KUB

ESHESKI RD

KUB

ESHESKI RD

KUB

ESHESKI RD

KUB

ESHESKI RD

KUB

ESHESKI RD

SIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDCH

IP
PA
W
A
RD
CH
IP
PA
W
A
RD
CH
IP
PA
W
A
RD
CH
IP
PA
W
A
RD
CH
IP
PA
W
A
RD
CH
IP
PA
W
A
RD
CH
IP
PA
W
A
RD
CH
IP
PA
W
A
RD
CH
IP
PA
W
A
RD

CALLAGHAN LANECALLAGHAN LANECALLAGHAN LANECALLAGHAN LANECALLAGHAN LANECALLAGHAN LANECALLAGHAN LANECALLAGHAN LANECALLAGHAN LANECRA

IG
M
O

NT RD

C RAIG

M
O

NT RD

C RAIG

M
O

NT RD

C RAIG

M
O

NT RD

C RAIG

M
O

NT RD

C RAIG

M
O

NT RD

C RAIG

M
O

NT RD

C RAIG

M
O

NT RD

C RAIG

M
O

NT RD

HASS RDHASS RDHASS RDHASS RDHASS RDHASS RDHASS RDHASS RDHASS RDZAPPA RDZAPPA RDZAPPA RDZAPPA RDZAPPA RDZAPPA RDZAPPA RDZAPPA RDZAPPA RDBROWNS RDBROWNS RDBROWNS RDBROWNS RDBROWNS RDBROWNS RDBROWNS RDBROWNS RDBROWNS RDREG

AN R DR EGAN R DR EGAN R DR EGAN R DR EGAN R DR EGAN R DR EGAN R DR EGAN R DR EGAN R DPA

UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D
PA
UG
H
LA
KE
R
D

PAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDMAIKA RDMAIKA RDMAIKA RDMAIKA RDMAIKA RDMAIKA RDMAIKA RDMAIKA RDMAIKA RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSC

EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D

STANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDSTANLEY OLSHESKI RDCAMPBELLS LAKE LANECAMPBELLS LAKE LANECAMPBELLS LAKE LANECAMPBELLS LAKE LANECAMPBELLS LAKE LANECAMPBELLS LAKE LANECAMPBELLS LAKE LANECAMPBELLS LAKE LANECAMPBELLS LAKE LANEW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDLAURIE R AVEL AUR IE R AVEL AUR IE R AVEL AUR IE R AVEL AUR IE R AVEL AUR IE R AVEL AUR IE R AVEL AUR IE R AVEL AUR IE R AVEMILLER RD

MILLER RD

MILLER RD

MILLER RD

MILLER RD

MILLER RD

MILLER RD

MILLER RD

MILLER RD

PLANT RDPLANT RDPLANT RDPLANT RDPLANT RDPLANT RDPLANT RDPLANT RDPLANT RDPL

AN
T R
D
PL
AN
T R
D
PL
AN
T R
D
PL
AN
T R
D
PL
AN
T R
D
PL
AN
T R
D
PL
AN
T R
D
PL
AN
T R
D
PL
AN
T R
D
PLA

NT RD

PLA

NT RD

PLA

NT RD

PLA

NT RD

PLA

NT RD

PLA

NT RD

PLA

NT RD

PLA

NT RD

PLA

NT RD

RIVER BEND DRRIVER BEND DRRIVER BEND DRRIVER BEND DRRIVER BEND DRRIVER BEND DRRIVER BEND DRRIVER BEND DRRIVER BEND DRLOW

ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
LOW
ER
ROS
ENT
HAL
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD
U
P P
ER
R
O
SE
NT
HA
L
RD

LOST NATION RDLOST NATION RDLOST NATION RDLOST NATION RDLOST NATION RDLOST NATION RDLOST NATION RDLOST NATION RDLOST NATION RDHARTWICK RANCH RDHARTWICK RANCH RDHARTWICK RANCH RDHARTWICK RANCH RDHARTWICK RANCH RDHARTWICK RANCH RDHARTWICK RANCH RDHARTWICK RANCH RDHARTWICK RANCH RDG

UI NEY RDG

UI NEY RDG

UI NEY RDG

UI NEY RDG

UI NEY RDG

UI NEY RDG

UI NEY RDG

UI NEY RDG

UI NEY RDAXE LAKE RDAXE LAKE RDAXE LAKE RDAXE LAKE RDAXE LAKE RDAXE LAKE RDAXE LAKE RDAXE LAKE RDAXE LAKE RDPE

LLS
LA
NE
PE
LLS
LA
NE
PE
LLS
LA
NE
PE
LLS
LA
NE
PE
LLS
LA
NE
PE
LLS
LA
NE
PE
LLS
LA
NE
PE
LLS
LA
NE
PE
LLS
LA
NE
C

EDAR GRO

VE RDC

EDAR GRO

VE RDC

EDAR GRO

VE RDC

EDAR GRO

VE RDC

EDAR GRO

VE RDC

EDAR GRO

VE RDC

EDAR GRO

VE RDC

EDAR GRO

VE RDC

EDAR GRO

VE RDM

AD
IG
AN
R
D
M
AD
IG
AN
R
D
M
AD
IG
AN
R
D
M
AD
IG
AN
R
D
M
AD
IG
AN
R
D
M
AD
IG
AN
R
D
M
AD
IG
AN
R
D
M
AD
IG
AN
R
D
M
AD
IG
AN
R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
MA
DI
GA
N R
D
W
EL
KS
R
D
W
EL
KS
R
D
W
EL
KS
R
D
W
EL
KS
R
D
W
EL
KS
R
D
W
EL
KS
R
D
W
EL
KS
R
D
W
EL
KS
R
D
W
EL
KS
R
D
SCE

NIC RD

SCE

NIC RD

SCE

NIC RD

SCE

NIC RD

SCE

NIC RD

SCE

NIC RD

SCE

NIC RD

SCE

NIC RD

SCE

NIC RD

SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
SC
EN
IC
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D
GR
OU
SE
R
D

PRINCE RDPRINCE RDPRINCE RDPRINCE RDPRINCE RDPRINCE RDPRINCE RDPRINCE RDPRINCE RDHAWKINS RDHAWKINS RDHAWKINS RDHAWKINS RDHAWKINS RDHAWKINS RDHAWKINS RDHAWKINS RDHAWKINS RDHUBERS RDHUBERS RDHUBERS RDHUBERS RDHUBERS RDHUBERS RDHUBERS RDHUBERS RDHUBERS RDGO

RM
AN
R
D
GO
RM
AN
R
D
GO
RM
AN
R
D
GO
RM
AN
R
D
GO
RM
AN
R
D
GO
RM
AN
R
D
GO
RM
AN
R
D
GO
RM
AN
R
D
GO
RM
AN
R
D
R O
C

KY POIN T DR

R O
C

KY POIN T DR

R O
C

KY POIN T DR

R O
C

KY POIN T DR

R O
C

KY POIN T DR

R O
C

KY POIN T DR

R O
C

KY POIN T DR

R O
C

KY POIN T DR

R O
C

KY POIN T DR

G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y
G
O

L DE N LY N WA

Y

LOG VIEW RD

LOG VIEW RD

LOG VIEW RD

LOG VIEW RD

LOG VIEW RD

LOG VIEW RD

LOG VIEW RD

LOG VIEW RD

LOG VIEW RD

SACRED HEART RDSACRED HEART RDSACRED HEART RDSACRED HEART RDSACRED HEART RDSACRED HEART RDSACRED HEART RDSACRED HEART RDSACRED HEART RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDKAR

GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FE
LH
AB
ER
R
D
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD
FIR
E T
OW
ER
RD

LAKE CLEAR RDLAKE CLEAR RDLAKE CLEAR RDLAKE CLEAR RDLAKE CLEAR RDLAKE CLEAR RDLAKE CLEAR RDLAKE CLEAR RDLAKE CLEAR RDPARRY SOUND RDPARRY SOUND RDPARRY SOUND RDPARRY SOUND RDPARRY SOUND RDPARRY SOUND RDPARRY SOUND RDPARRY SOUND RDPARRY SOUND RDKAR

GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
KAR
GUS
RD
SC
HA
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
SC
H A
VE
NS
L
AK
E
RD
W
OL
FE
R
D
W
OL
FE
R
D
W
OL
FE
R
D
W
OL
FE
R
D
W
OL
FE
R
D
W
OL
FE
R
D
W
OL
FE
R
D
W
OL
FE
R
D
W
OL
FE
R
D

SCHAUER RDSCHAUER RDSCHAUER RDSCHAUER RDSCHAUER RDSCHAUER RDSCHAUER RDSCHAUER RDSCHAUER RDHOFFMAN RDHOFFMAN RDHOFFMAN RDHOFFMAN RDHOFFMAN RDHOFFMAN RDHOFFMAN RDHOFFMAN RDHOFFMAN RDLAKE C L E AR RD

L AKE C L E AR RD

L AKE C L E AR RD

L AKE C L E AR RD

L AKE C L E AR RD

L AKE C L E AR RD

L AKE C L E AR RD

L AKE C L E AR RD

L AKE C L E AR RD

MU
D L
AK
E R
D
MU
D L
AK
E R
D
MU
D L
AK
E R
D
MU
D L
AK
E R
D
MU
D L
AK
E R
D
MU
D L
AK
E R
D
MU
D L
AK
E R
D
MU
D L
AK
E R
D
MU
D L
AK
E R
D
M

ANNING RDM

ANNING RDM

ANNING RDM

ANNING RDM

ANNING RDM

ANNING RDM

ANNING RDM

ANNING RDM

ANNING RDMERGANSER WAYMERGANSER WAYMERGANSER WAYMERGANSER WAYMERGANSER WAYMERGANSER WAYMERGANSER WAYMERGANSER WAYMERGANSER WAYW

ITTKE RDW

ITTKE RDW

ITTKE RDW

ITTKE RDW

ITTKE RDW

ITTKE RDW

ITTKE RDW

ITTKE RDW

ITTKE RDNOP

OMING INAMO

NOP

OMING INAMO

NOP

OMING INAMO

NOP

OMING INAMO

NOP

OMING INAMO

NOP

OMING INAMO

NOP

OMING INAMO

NOP

OMING INAMO

NOP

OMING INAMO

MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
FO
YM
O

UNT RDFO

YM
O

UNT RDFO

YM
O

UNT RDFO

YM
O

UNT RDFO

YM
O

UNT RDFO

YM
O

UNT RDFO

YM
O

UNT RDFO

YM
O

UNT RDFO

YM
O

UNT RDL ENSER RDL ENSER RDL ENSER RDL ENSER RDL ENSER RDL ENSER RDL ENSER RDL ENSER RDL ENSER RDDO

NEG

AL RDDO

NEG

AL RDDO

NEG

AL RDDO

NEG

AL RDDO

NEG

AL RDDO

NEG

AL RDDO

NEG

AL RDDO

NEG

AL RDDO

NEG

AL RDBLUEBILL TRAILBLUEBILL TRAILBLUEBILL TRAILBLUEBILL TRAIL

BLUEBILL TRAILBLUEBILL TRAILBLUEBILL TRAILBLUEBILL TRAILBLUEBILL TRAILKELLER RDKELLER RDKELLER RDKELLER RDKELLER RDKELLER RDKELLER RDKELLER RDKELLER RDMCGRATH RDMCGRATH RDMCGRATH RDMCGRATH RDMCGRATH RDMCGRATH RDMCGRATH RDMCGRATH RDMCGRATH RDMC

GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
MC
GR
AT
H
RD
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR
PO
INT
CH
UR
CH
DR

LETTS CEMETERY RDLETTS CEMETERY RDLETTS CEMETERY RDLETTS CEMETERY RDLETTS CEMETERY RDLETTS CEMETERY RDLETTS CEMETERY RDLETTS CEMETERY RDLETTS CEMETERY RDW

ILKENS RDW

ILKENS RDW

ILKENS RDW

ILKENS RDW

ILKENS RDW

ILKENS RDW

ILKENS RDW

ILKENS RDW

ILKENS RDFO

UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D
FO
UR
TH
C
HU
TE
R
D

FILLMAN TRAILFILLMAN TRAILFILLMAN TRAILFILLMAN TRAILFILLMAN TRAILFILLMAN TRAILFILLMAN TRAILFILLMAN TRAILFILLMAN TRAILM

A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD
M
A R
CH
A N
D
LA
CO
U
RS
E
RD

LONG LAKE RDLONG LAKE RDLONG LAKE RDLONG LAKE RDLONG LAKE RDLONG LAKE RDLONG LAKE RDLONG LAKE RDLONG LAKE RDFINCHLEY RDFINCHLEY RDFINCHLEY RDFINCHLEY RDFINCHLEY RDFINCHLEY RDFINCHLEY RDFINCHLEY RDFINCHLEY RDDO

GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
DO
GW
OO
D
TR
AI
L
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
MA
CF
AR
LA
NE
RD
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL
GR
EA
TV
IEW
TR
AIL

HEIDEMAN RD

HEIDEMAN RD

HEIDEMAN RD

HEIDEMAN RD

HEIDEMAN RD

HEIDEMAN RD

HEIDEMAN RD

HEIDEMAN RD

HEIDEMAN RD MCMASTER RDMCMASTER RD

MCMASTER RD

MCMASTER RD

MCMASTER RD

MCMASTER RD

MCMASTER RD

MCMASTER RD

MCMASTER RD

SCO
TC

H BUSH RDSCO

TC

H BUSH RDSCO

TC

H BUSH RDSCO

TC

H BUSH RDSCO

TC

H BUSH RDSCO

TC

H BUSH RDSCO

TC

H BUSH RDSCO

TC

H BUSH RDSCO

TC

H BUSH RDBE

AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E
BE
AU
D
RY
L
AN
E

FIEBIG RD

FIEBIG RD

FIEBIG RDFIEBIG RD

FIEBIG RDFIEBIG RD

FIEBIG RD

FIEBIG RDFIEBIG RD

BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
BR
AD
LE
Y L
AN
E
KEN

DICK RDKEN

DICK RDKEN

DICK RDKEN

DICK RDKEN

DICK RDKEN

DICK RDKEN

DICK RDKEN

DICK RDKEN

DICK RDCH

RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
CH
RIS
RU
DD
Y R
D
MH
US
K R
D
MH
US
K R
D
MH
US
K R
D
MH
US
K R
D
MH
US
K R
D
MH
US
K R
D
MH
US
K R
D
MH
US
K R
D
MH
US
K R
D

CHRIS RUDDY RDCHRIS RUDDY RDCHRIS RUDDY RDCHRIS RUDDY RDCHRIS RUDDY RDCHRIS RUDDY RDCHRIS RUDDY RDCHRIS RUDDY RDCHRIS RUDDY RDCL

AR
K
RD
C L
AR
K
RD
C L
AR
K
RD
C L
AR
K
RD
C L
AR
K
RD
C L
AR
K
RD
C L
AR
K
RD
C L
AR
K
RD
C L
AR
K

RDMALO

NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
MA
LO
NE
Y M
OU
NT
AIN
RD
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
AL
O
NE
Y
M
O
U N
T A
I N
R
D
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
M
O
UN
T
ST
P
A
TR
IC
K
RD
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D
MO
UNT

ST PAT

RIC
K R
D

COLTERMAN RDCOLTERMAN RDCOLTERMAN RDCOLTERMAN RDCOLTERMAN RDCOLTERMAN RDCOLTERMAN RDCOLTERMAN RDCOLTERMAN RDFLAT RDFLAT RDFLAT RDFLAT RDFLAT RDFLAT RDFLAT RDFLAT RDFLAT RDSPENCE RDSPENCE RDSPENCE RDSPENCE RDSPENCE RDSPENCE RDSPENCE RDSPENCE RDSPENCE RDPR

OV
EN
LI
NE
PR
OV
EN
LI
NE
PR
OV
EN
LI
NE
PR
OV
EN
LI
NE
PR
OV
EN
LI
NE
PR
OV
EN
LI
NE
PR
OV
EN
LI
NE
PR
OV
EN
LI
NE
PR
OV
EN
LI
NE

LEACH RDLEACH RDLEACH RDLEACH RDLEACH RDLEACH RDLEACH RDLEACH RDLEACH RDBARR LINEBARR LINEBARR LINEBARR LINEBARR LINEBARR LINEBARR LINEBARR LINEBARR LINECO

LT
ON
R
D
CO
LT
ON
R
D
CO
LT
ON
R
D
CO
LT
ON
R
D
CO
LT
ON
R
D
CO
LT
ON
R
D
CO
LT
ON
R
D
CO
LT
ON
R
D
CO
LT
ON
R
D
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
WH
ISP
ER
ING
PI
NE
S L
AN
E
K
EL
LY
S
RD
K
EL
LY
S
RD
K
EL
LY
S
RD
K
EL
LY
S
RD
K
EL
LY
S
RD
K
EL
LY
S
RD
K
EL
LY
S
RD
K
EL
LY
S
RD
K
EL
LY
S
RD

GAUTHIER RDGAUTHIER RDGAUTHIER RDGAUTHIER RDGAUTHIER RDGAUTHIER RDGAUTHIER RDGAUTHIER RDGAUTHIER RDYAKABUSKIE RDYAKABUSKIE RDYAKABUSKIE RDYAKABUSKIE RDYAKABUSKIE RDYAKABUSKIE RDYAKABUSKIE RDYAKABUSKIE RDYAKABUSKIE RDGE

RV
AI
S
RD
GE
RV
AI
S
RD
GE
RV
AI
S
RD
GE
RV
AI
S
RD
GE
RV
AI
S
RD
GE
RV
AI
S
RD
GE
RV
AI
S
RD
GE
RV
AI
S
RD
GE
RV
AI
S
RD
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
BR
AN
CH
T
RA
I L
W
R
IG
H

T RDW

R
IG
H

T RDW

R
IG
H

T RDW

R
IG
H

T RDW

R
IG
H

T RDW

R
IG
H

T RDW

R
IG
H

T RDW

R
IG
H

T RDW

R
IG
H

T RDPU

RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
PU
RP
LE
F
IN
D
TR
AI
L
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
CU
RT
IS
TR
AIL
M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

M
O
R
G

LA NS T RAIL

HILLTOP DRHILLTOP DRHILLTOP DRHILLTOP DRHILLTOP DRHILLTOP DRHILLTOP DRHILLTOP DRHILLTOP DRBRISCOE RDBRISCOE RDBRISCOE RDBRISCOE RDBRISCOE RDBRISCOE RDBRISCOE RDBRISCOE RDBRISCOE RDNO

RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D
NO
RT
HC
OT
E
RI
NK
R
D

PLAUNT RDP L AUNT RDP L AUNT RDP L AUNT RDP L AUNT RDP L AUNT RDP L AUNT RDP L AUNT RDP L AUNT RDCU

LH
AN
E R
D
CU
LH
AN
E R
D
CU
LH
AN
E R
D
CU
LH
AN
E R
D
CU
LH
AN
E R
D
CU
LH
AN
E R
D
CU
LH
AN
E R
D
CU
LH
AN
E R
D
CU
LH
AN
E R
D
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD
GR
AN
TS
S
ET
TL
EM
EN
T
RD

UTONKI RDUTONKI RDUTONKI RDUTONKI RDUTONKI RDUTONKI RDUTONKI RDUTONKI RDUTONKI RDPETITGREW RDPETITGREW RDPETITGREW RDPETITGREW RDPETITGREW RDPETITGREW RDPETITGREW RDPETITGREW RDPETITGREW RDRI

ED
RD
RI
ED
RD
RI
ED
RD
RI
ED
RD
RI
ED
RD
RI
ED
RD
RI
ED
RD
RI
ED
RD
RI
ED
RD
M
CM

AHON RDM

CM

AHON RDM

CM

AHON RDM

CM

AHON RDM

CM

AHON RDM

CM

AHON RDM

CM

AHON RDM

CM

AHON RDM

CM

AHON RDM

C M
A H
O

N RDM

C M
A H
O

N RDM

C M
A H
O

N RDM

C M
A H
O

N RDM

C M
A H
O

N RDM

C M
A H
O

N RDM

C M
A H
O

N RDM

C M
A H
O

N RDM

C M
A H
O

N RDBYERS RDBYERS RDBYERS RDBYERS RDBYERS RDBYERS RDBYERS RDBYERS RDBYERS RDLONG POINT WAYLONG POINT WAYLONG POINT WAYLONG POINT WAYLONG POINT WAYLONG POINT WAYLONG POINT WAYLONG POINT WAYLONG POINT WAYBLACKBURN RDBLACKBURN RDBLACKBURN RDBLACKBURN RDBLACKBURN RDBLACKBURN RDBLACKBURN RDBLACKBURN RDBLACKBURN RDNO

R

TH K & P TRAI LN O

R

TH K & P TRAI LN O

R

TH K & P TRAI LN O

R

TH K & P TRAI LN O

R

TH K & P TRAI LN O

R

TH K & P TRAI LN O

R

TH K & P TRAI LN O

R

TH K & P TRAI LN O

R

TH K & P TRAI LWI

LK
INS
LA
NE
WI
LK
INS
LA
NE
WI
LK
INS
LA
NE
WI
LK
INS
LA
NE
WI
LK
INS
LA
NE
WI
LK
INS
LA
NE
WI
LK
INS
LA
NE
WI
LK
INS
LA
NE
WI
LK
INS
LA
NE
GR
AN
T R
D
GR
AN
T R
D
GR
AN
T R
D
GR
AN
T R
D
GR
AN
T R
D
GR
AN
T R
D
GR
AN
T R
D
GR
AN
T R
D
GR
AN
T R
D
HA
LL
AV
E E
HA
LL
AV
E E
HA
LL
AV
E E
HA
LL
AV
E E
HA
LL
AV
E E
HA
LL
AV
E E
HA
LL
AV
E E
HA
LL
AV
E E
HA
LL
AV
E E

KARADORKI RDKARADORKI RDKARADORKI RDKARADORKI RDKARADORKI RDKARADORKI RDKARADORKI RDKARADORKI RDKARADORKI RD6 ST6 ST6 ST6 ST6 ST6 ST6 ST6 ST6 STCO

LO
NY
L
AN
E
CO
LO
NY
L
AN
E
CO
LO
NY
L
AN
E
CO
LO
NY
L
AN
E
CO
LO
NY
L
AN
E
CO
LO
NY
L
AN
E
CO
LO
NY
L
AN
E
CO
LO
NY
L
AN
E
CO
LO
NY
L
AN
E

LODGE LANELODGE LANELODGE LANELODGE LANELODGE LANELODGE LANELODGE LANELODGE LANELODGE LANEK

&
P
TR
AI
L
K
&
P
TR
AI
L
K
&
P
TR
AI
L
K
&
P
TR
AI
L
K
&
P
TR
AI
L
K
&
P
TR
AI
L
K
&
P
TR
AI
L
K
&
P
TR
AI
L
K
&
P
TR
AI
L

STOUGHTON SIDEROADSTOUGHTON SIDEROADSTOUGHTON SIDEROADSTOUGHTON SIDEROADSTOUGHTON SIDEROADSTOUGHTON SIDEROADSTOUGHTON SIDEROADSTOUGHTON SIDEROADSTOUGHTON SIDEROADST

ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
ST
ON
ES
L
AK
E
RD
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL
TR
IA
NG
LE
T
RA
IL

ASPEN RDASPEN RDASPEN RDASPEN RDASPEN RDASPEN RDASPEN RDASPEN RDASPEN RDFR

AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
RD
FR
AS
ER
R
D
FR
AS
ER
R
D
FR
AS
ER
R
D
FR
AS
ER
R
D
FR
AS
ER
R
D
FR
AS
ER
R
D
FR
AS
ER
R
D
FR
AS
ER
R
D
FR
AS
ER
R
D
MC
HU
GH
RD
MC
HU
GH
RD
MC
HU
GH
RD
MC
HU
GH
RD
MC
HU
GH
RD
MC
HU
GH
RD
MC
HU
GH
RD
MC
HU
GH
RD
MC
HU
GH
RD

PALLEN RDPALLEN RDPALLEN RDPALLEN RDPALLEN RDPALLEN RDPALLEN RDPALLEN RDPALLEN RDJULIE LANEJULIE LANEJULIE LANEJULIE LANEJULIE LANEJULIE LANEJULIE LANEJULIE LANEJULIE LANEKEITH RDKEITH RDKEITH RDKEITH RDKEITH RDKEITH RDKEITH RDKEITH RDKEITH RDFERGUSO

N RDFERGUSO

N RDFERGUSO

N RDFERGUSO

N RDFERGUSO

N RDFERGUSO

N RDFERGUSO

N RDFERGUSO

N RDFERGUSO

N RDARNOLD LANEARNOLD LANEARNOLD LANEARNOLD LANEARNOLD LANEARNOLD LANEARNOLD LANEARNOLD LANEARNOLD LANEMILL RIDGE RDMILL RIDGE RDMILL RIDGE RDMILL RIDGE RDMILL RIDGE RDMILL RIDGE RDMILL RIDGE RDMILL RIDGE RDMILL RIDGE RDJESSIE RDJESSIE RDJESSIE RDJESSIE RDJESSIE RDJESSIE RDJESSIE RDJESSIE RDJESSIE RDDEERFIELD DRDEERFIELD DRDEERFIELD DRDEERFIELD DRDEERFIELD DRDEERFIELD DRDEERFIELD DRDEERFIELD DRDEERFIELD DRVAN DUSEN DRVAN DUSEN DRVAN DUSEN DRVAN DUSEN DRVAN DUSEN DRVAN DUSEN DRVAN DUSEN DRVAN DUSEN DRVAN DUSEN DRNE

ILS
ON
ST
NE
ILS
ON
ST
NE
ILS
ON
ST
NE
ILS
ON
ST
NE
ILS
ON
ST
NE
ILS
ON
ST
NE
ILS
ON
ST
NE
ILS
ON
ST
NE
ILS
ON
ST

7 AVE7 AVE7 AVE7 AVE7 AVE7 AVE7 AVE7 AVE7 AVEROSE HILL RDROSE HILL RDROSE HILL RDROSE HILL RDROSE HILL RDROSE HILL RDROSE HILL RDROSE HILL RDROSE HILL RD AIROS LA KE RD

A IROS LA KE RD

A IROS LA KE RD

A IROS LA KE RD

A IROS LA KE RD

A IROS LA KE RD

A IROS LA KE RD

A IROS LA KE RD

A IROS LA KE RD

KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
KEN
NEL

LY MOUN

TAI
N R
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D
CA
MP
GR
OU
ND
S
ID
ER
OA
D

LITTLE IRELAND RDLITTLE IRELAND RDLITTLE IRELAND RDLITTLE IRELAND RDLITTLE IRELAND RDLITTLE IRELAND RDLITTLE IRELAND RDLITTLE IRELAND RDLITTLE IRELAND RDKE

LL
ER
R
D
KE
LL
ER
R
D
KE
LL
ER
R
D
KE
LL
ER
R
D
KE
LL
ER
R
D
KE
LL
ER
R
D
KE
LL
ER
R
D
KE
LL
ER
R
D
KE
LL
ER
R
DK
EL
LE
R R
D
KE
LL
ER
RD
KE
LL
ER
RD
KE
LL
ER
RD
KE
LL
ER
RD
KE
LL
ER
RD
KE
LL
ER
RD
KE
LL
ER
RD
KE
LL
ER
RD

SLATE FALLS RDSLATE FALLS RDSLATE FALLS RDSLATE FALLS RDSLATE FALLS RDSLATE FALLS RDSLATE FALLS RDSLATE FALLS RDSLATE FALLS RDMILTY LAKE RDMILTY LAKE RDMILTY LAKE RDMILTY LAKE RDMILTY LAKE RDMILTY LAKE RDMILTY LAKE RDMILTY LAKE RDMILTY LAKE RDTEEPLE HALEY RDTEEPLE HALEY RDTEEPLE HALEY RDTEEPLE HALEY RDTEEPLE HALEY RDTEEPLE HALEY RDTEEPLE HALEY RDTEEPLE HALEY RDTEEPLE HALEY RDTE

EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
TE
EP
LE
H
A L
EY
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
W
AL
FO
RD
R
D
VIM
Y R
D
VIM
Y R
D
VIM
Y R
D
VIM
Y R
D
VIM
Y R
D
VIM
Y R
D
VIM
Y R
D
VIM
Y R
D
VIM
Y R
D

LIRI STLIRI STLIRI STLIRI STLIRI STLIRI STLIRI STLIRI STLIRI STHUNTS RDHUNTS RDHUNTS RDHUNTS RDHUNTS RDHUNTS RDHUNTS RDHUNTS RDHUNTS RDABBIE LANEABBIE LANEABBIE LANEABBIE LANEABBIE LANEABBIE LANEABBIE LANEABBIE LANEABBIE LANEBUCHOLTZ RDBUCHOLTZ RDBUCHOLTZ RDBUCHOLTZ RDBUCHOLTZ RDBUCHOLTZ RDBUCHOLTZ RDBUCHOLTZ RDBUCHOLTZ RDLA

PO
INT
E S
T
LA
PO
INT
E S
T
LA
PO
INT
E S
T
LA
PO
INT
E S
T
LA
PO
INT
E S
T
LA
PO
INT
E S
T
LA
PO
INT
E S
T
LA
PO
INT
E S
T
LA
PO
INT
E S
T
RAD

TKE RD

RAD

TKE RD

RAD

TKE RD

RAD

TKE RD

RAD

TKE RD

RAD

TKE RD

RAD

TKE RD

RAD

TKE RD

RAD

TKE RD

METZ RDMETZ RDMETZ RDMETZ RDMETZ RDMETZ RDMETZ RDMETZ RDMETZ RDFER

N D
R
FER
N D
R
FER
N D
R
FER
N D
R
FER
N D
R
FER
N D
R
FER
N D
R
FER
N D
R
FER
N D
R

EICHSTAEDT RDEICHSTAEDT RDEICHSTAEDT RDEICHSTAEDT RDEICHSTAEDT RDEICHSTAEDT RDEICHSTAEDT RDEICHSTAEDT RDEICHSTAEDT RDBORNE RDBORNE RDBORNE RDBORNE RDBORNE RDBORNE RDBORNE RDBORNE RDBORNE RDCARLA STCARLA STCARLA STCARLA STCARLA STCARLA STCARLA STCARLA STCARLA STE LIZABE TH ST NE LIZABE TH ST NE LIZABE TH ST NE LIZABE TH ST NE LIZABE TH ST NE LIZABE TH ST NE LIZABE TH ST NE LIZABE TH ST NE LIZABE TH ST NWILSON RDWILSON RDWILSON RDWILSON RDWILSON RDWILSON RDWILSON RDWILSON RDWILSON RDBESS STBESS STBESS STBESS STBESS STBESS STBESS STBESS STBESS STLANEWAY RDLANEWAY RDLANEWAY RDLANEWAY RDLANEWAY RDLANEWAY RDLANEWAY RDLANEWAY RDLANEWAY RDLUBITZ RDLUBITZ RDLUBITZ RDLUBITZ RDLUBITZ RDLUBITZ RDLUBITZ RDLUBITZ RDLUBITZ RDHE

NA
N R
D
HE
NA
N R
D
HE
NA
N R
D
HE
NA
N R
D
HE
NA
N R
D
HE
NA
N R
D
HE
NA
N R
D
HE
NA
N R
D
HE
NA
N R
D

B LINE RDB LINE RDB LINE RDB LINE RDB LINE RDB LINE RDB LINE RDB LINE RDB LINE RDSUM

MER

S RDSUM

MER

S RDSUM

MER

S RDSUM

MER

S RDSUM

MER

S RDSUM

MER

S RDSUM

MER

S RDSUM

MER

S RDSUM

MER

S RDBRAZEAU RDBRAZEAU RDBRAZEAU RDBRAZEAU RDBRAZEAU RDBRAZEAU RDBRAZEAU RDBRAZEAU RDBRAZEAU RDWYLIE RD

WYLIE RD

WYLIE RDWYLIE RD

WYLIE RDWYLIE RD

WYLIE RD

WYLIE RDWYLIE RD

SAUMSAUMSAUMSAUMSAUMSAUMSAUMSAUMSAUMSP

RU
CE
DR
SP
RU
CE
DR
SP
RU
CE
DR
SP
RU
CE
DR
SP
RU
CE
DR
SP
RU
CE
DR
SP
RU
CE
DR
SP
RU
CE
DR
SP
RU
CE
DR
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D
CR
OW
N
PO
INT
R
D

STONECREST RDSTONECREST RDSTONECREST RDSTONECREST RDSTONECREST RDSTONECREST RDSTONECREST RDSTONECREST RDSTONECREST RDCOT

TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

TIM
M R
D
TIM
M R
D
TIM
M R
D
TIM
M R
D
TIM
M R
D
TIM
M R
D
TIM
M R
D
TIM
M R
D
TIM
M R
D
SA
AR
S L
AN
E
SA
AR
S L
AN
E
SA
AR
S L
AN
E
SA
AR
S L
AN
E
SA
AR
S L
AN
E
SA
AR
S L
AN
E
SA
AR
S L
AN
E
SA
AR
S L
AN
E
SA
AR
S L
AN
E
W

ENDIGO WAY

W

ENDIGO WAY

W

ENDIGO WAY

W

ENDIGO WAY

W

ENDIGO WAY

W

ENDIGO WAY

W

ENDIGO WAY

W

ENDIGO WAY

W

ENDIGO WAY

ROBIN RDROBIN RDROBIN RDROBIN RDROBIN RDROBIN RDROBIN RDROBIN RDROBIN RDSC

OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
SC
OT
CH
PI
NE
GR
OV
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
TI
MB
ER
L
AN
E
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
ST
YL
ES
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD
CA
RR
YS
SI
DE
RD

FOREST EDGE RDFOREST EDGE RDFOREST EDGE RDFOREST EDGE RDFOREST EDGE RDFOREST EDGE RDFOREST EDGE RDFOREST EDGE RDFOREST EDGE RDVA

NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD
VA
NC
ES
SI
DE
RD

FARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDFARMVIEW RDGR

AN
TS
SI
DE
RD
GR
AN
TS
SI
DE
RD
GR
AN
TS
SI
DE
RD
GR
AN
TS
SI
DE
RD
GR
AN
TS
SI
DE
RD
GR
AN
TS
SI
DE
RD
GR
AN
TS
SI
DE
RD
GR
AN
TS
SI
DE
RD
GR
AN
TS
SI
DE

RD JOHN SHAW RDJOHN SHAW RDJOHN SHAW RDJOHN SHAW RDJOHN SHAW RDJOHN SHAW RDJOHN SHAW RDJOHN SHAW RDJOHN SHAW RDWILLIAM MOONEY RDWILLIAM MOONEY RDWILLIAM MOONEY RDWILLIAM MOONEY RDWILLIAM MOONEY RDWILLIAM MOONEY RDWILLIAM MOONEY RDWILLIAM MOONEY RDWILLIAM MOONEY RDWHISTLER RDWHISTLER RDWHISTLER RDWHISTLER RDWHISTLER RDWHISTLER RDWHISTLER RDWHISTLER RDWHISTLER RDAR

M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
A R
M
I T
A G
E
A V
E
SA
W
G
RA

SS CIRSA

W
G
RA

SS CIRSA

W
G
RA

SS CIRSA

W
G
RA

SS CIRSA

W
G
RA

SS CIRSA

W
G
RA

SS CIRSA

W
G
RA

SS CIRSA

W
G
RA

SS CIRSA

W
G
RA

SS CIRK & P T RA I LK & P T RA I LK & P T RA I LK & P T RA I LK & P T RA I LK & P T RA I LK & P T RA I LK & P T RA I LK & P T RA I LTHOMAS ELLIOT RDTHOMAS ELLIOT RDTHOMAS ELLIOT RDTHOMAS ELLIOT RDTHOMAS ELLIOT RDTHOMAS ELLIOT RDTHOMAS ELLIOT RDTHOMAS ELLIOT RDTHOMAS ELLIOT RDWHITETAIL DRWHITETAIL DRWHITETAIL DRWHITETAIL DRWHITETAIL DRWHITETAIL DRWHITETAIL DRWHITETAIL DRWHITETAIL DRCONCESSION RD 5CONCESSION RD 5CONCESSION RD 5CONCESSION RD 5CONCESSION RD 5CONCESSION RD 5CONCESSION RD 5CONCESSION RD 5CONCESSION RD 5CONCECONCECONCCONCECONCCONCECONCECONCCONCESOUTH BUSH RDSOUTH BUSH RDSOUTH BUSH RDSOUTH BUSH RDSOUTH BUSH RDSOUTH BUSH RDSOUTH BUSH RDSOUTH BUSH RDSOUTH BUSH RDVA

UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
VA
UG
HA
N
SID
E R
D
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
LE
AR
MO
NT
H A
VE
CA

NAD IA N DRC A

N AD IA N DRC A

N AD IA N DRC A

N AD IA N DRC A

N AD IA N DRC A

N AD IA N DRC A

N AD IA N DRC A

N AD IA N DRC A

N AD IA N DRBAYVIEW DR

BAYVIEW DR

BAYVIEW DR

BAYVIEW DR

BAYVIEW DR

BAYVIEW DR

BAYVIEW DR

BAYVIEW DR

BAYVIEW DR

PETER ROBINSON RDPETER ROBINSON RDPETER ROBINSON RDPETER ROBINSON RDPETER ROBINSON RDPETER ROBINSON RDPETER ROBINSON RDPETER ROBINSON RDPETER ROBINSON RDHU

NT
L
IN
E
RD
HU
NT
L
IN
E
RD
HU
NT
L
IN
E
RD
HU
NT
L
IN
E
RD
HU
NT
L
IN
E
RD
HU
NT
L
IN
E
RD
HU
NT
L
IN
E
RD
HU
NT
L
IN
E
RD
HU
NT
L
IN
E
RD

MCCAFFREY TRAILMCCAFFREY TRAILMCCAFFREY TRAILMCCAFFREY TRAILMCCAFFREY TRAILMCCAFFREY TRAILMCCAFFREY TRAILMCCAFFREY TRAILMCCAFFREY TRAILSKI HILL RDSKI HILL RDSKI HILL RDSKI HILL RDSKI HILL RDSKI HILL RDSKI HILL RDSKI HILL RDSKI HILL RDLAVANT MILL RDLAVANT MILL RDLAVANT MILL RDLAVANT MILL RDLAVANT MILL RDLAVANT MILL RDLAVANT MILL RDLAVANT MILL RDLAVANT MILL RDNO

RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
NO
RT
H S
HO
RE
RD
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
HIG
HL
AN
D L
INE
MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

MEA
DOW
CRE

ST DR

ES
SI
O
N
R
D
2
E S
S I
O
N
R
D
2
S S
IO
N
R
D
2
E S
S I
O
N
R
D
2
S S
IO
N
R
D
2
E S
S I
O
N
R
D
2
E S
S I
O
N
R
D
2
S S
IO
N
R
D
2
E S
S I
O
N
R
D
2

FIFFFIFFIFFFENNIS RDENNIS RDENNIS RENNIS RDENNIS RENNIS RDENNIS RDENNIS RENNIS RDBA

TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
BA
TH
UR
ST
LI
NE
E
ON
RD
7
ON
RD
7
ON
RD
7
ON
RD
7
ON
RD
7
ON
RD
7
ON
RD
7
ON
RD
7
ON
RD
7

FLOWER STATION RDFLOWER STATION RDFLOWER STATION RDFLOWER STATION RDFLOWER STATION RDFLOWER STATION RDFLOWER STATION RDFLOWER STATION RDFLOWER STATION RDFLO

WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D
FLO
WE
R S
TA
TIO
N R
D

OLD GOVERNMENT RDOLD GOVERNMENT RDOLD GOVERNMENT RDOLD GOVERNMENT RDOLD GOVERNMENT RDOLD GOVERNMENT RDOLD GOVERNMENT RDOLD GOVERNMENT RDOLD GOVERNMENT RDUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SUM

PHERSONS MILL RD SCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 6BCONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4CONCESSION RD 4LAMMERMOOR RDLAMMERMOOR RDLAMMERMOOR RDLAMMERMOOR RDLAMMERMOOR RDLAMMERMOOR RDLAMMERMOOR RDLAMMERMOOR RDLAMMERMOOR RDAN

DE
RS
ON
R
D
AN
DE
RS
ON
R
D
AN
DE
RS
ON
R
D
AN
DE
RS
ON
R
D
AN
DE
RS
ON
R
D
AN
DE
RS
ON
R
D
AN
DE
RS
ON
R
D
AN
DE
RS
ON
R
D
AN
DE
RS
ON
R
D
LO
VE
S R
D
LO
VE
S R
D
LO
VE
S R
D
LO
VE
S R
D
LO
VE
S R
D
LO
VE
S R
D
LO
VE
S R
D
LO
VE
S R
D
LO
VE
S R
D

SUNSET BAYSUNSET BAYSUNSET BAYSUNSET BAY

SUNSET BAYSUNSET BAYSUNSET BAYSUNSET BAYSUNSET BAYLIT

TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
LIT
TL
E
GR
EE
N
RD
NEW
RD
NEW
RD
NEW

RDNEW RD

NEW

RDNEW RD

NEW
RD
NEW
RD
NEW
RD

DARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDCA

LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CA
LI
FO
RN
IA
R
D
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE
CO
LD
WE
LL
LA
NE

DARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDDARLING RDBEL

LAM
Y R
D
BEL
LAM
Y R
D
BEL
LAM
Y R
D
BEL
LAM
Y R
D
BEL
LAM
Y R
D
BEL
LAM
Y R
D
BEL
LAM
Y R
D
BEL
LAM
Y R
D
BEL
LAM
Y R
D
DA

RLING R DD A

R LI NG R DD A

R LI NG R DD A

R LI NG R DD A

R LI NG R DD A

R LI NG R DD A

R LI NG R DD A

R LI NG R DD A

R LI NG R DMURRO LINEMURRO LINEMURRO LINEMURRO LINEMURRO LINEMURRO LINEMURRO LINEMURRO LINEMURRO LINESU

GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
SU
GA
RB
US
H W
AY
FO
RB
ES
RD
FO
RB
ES
RD
FO
RB
ES
RD
FO
RB
ES
RD
FO
RB
ES
RD
FO
RB
ES
RD
FO
RB
ES
RD
FO
RB
ES
RD
FO
RB
ES
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD
SH
ER
IDA
N R
AP
IDS
RD

ASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDST

OR
IE
S
RD
ST
OR
IE
S
RD
ST
OR
IE
S
RD
ST
OR
IE
S
RD
ST
OR
IE
S
RD
ST
OR
IE
S
RD
ST
OR
IE
S
RD
ST
OR
IE
S
RD
ST
OR
IE
S
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
JOH

NS RD

JOH

NS RD

JOH

NS RD

JOH

NS RD

JOH

NS RD

JOH

NS RD

JOH

NS RD

JOH

NS RD

JOH

NS RD

RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD
RO
BE
RT
M
UR
RA
Y
RD

CONCESSION RD 7CONCESSION RD 7CONCESSION RD 7CONCESSION RD 7CONCESSION RD 7CONCESSION RD 7CONCESSION RD 7CONCESSION RD 7CONCESSION RD 7TR

OO
N
CR
T
TR
OO
N
CR
T
TR
OO
N
CR
T
TR
OO
N
CR
T
TR
OO
N
CR
T
TR
OO
N
CR
T
TR
OO
N
CR
T
TR
OO
N
CR
T
TR
OO
N
CR
T
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9
CON
CES
SIO
N R
D 9

BELLAMY RDBELLAMY RDBELLAMY RDBELLAMY RDBELLAMY RDBELLAMY RDBELLAMY RDBELLAMY RDBELLAMY RDBA

RR
IE
RD
BA
RR
IE
RD
BA
RR
IE
RD
BA
RR
IE
RD
BA
RR
IE
RD
BA
RR
IE
RD
BA
RR
IE
RD
BA
RR
IE
RD
BA
RR
IE

RD RYA

N
DU
NC
AN
S
ID
E
RD
RY
AN
D
UN
CA
N
SI
DE
R
D
RY
AN
D
UN
CA
N
SI
DE
R
D
RY
AN
D
UN
CA
N
SI
DE
R
D
RY
AN
D
UN
CA
N
SI
DE
R
D
RY
AN
D
UN
CA
N
SI
DE
R
D
RY
AN
D
UN
CA
N
SI
DE
R
D
RY
AN
D
UN
CA
N
SI
DE
R
D
RY
AN
D
UN
CA
N
SI
DE
R
D
CA
RB
IN
E
RD
CA
RB
IN
E
RD
CA
RB
IN
E
RD
CA
RB
IN
E
RD
CA
RB
IN
E
RD
CA
RB
IN
E
RD
CA
RB
IN
E
RD
CA
RB
IN
E
RD
CA
RB
IN
E
RD

CONCESSION RD 6CONCESSION RD 6CONCESSION RD 6CONCESSION RD 6CONCESSION RD 6CONCESSION RD 6CONCESSION RD 6CONCESSION RD 6CONCESSION RD 6CONCESSION RD 7SCONCESSION RD 7SCONCESSION RD 7SCONCESSION RD 7SCONCESSION RD 7SCONCESSION RD 7SCONCESSION RD 7SCONCESSION RD 7SCONCESSION RD 7SBE

NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D
BE
NN
IES
CO
RN
ER
S R
D

CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2CONCESSION RD 2GIB

SO
N R
D
GIB
SO
N R
D
GIB
SO
N R
D
GIB
SO
N R
D
GIB
SO
N R
D
GIB
SO
N R
D
GIB
SO
N R
D
GIB
SO
N R
D
GIB
SO
N R
D
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
RO
SE
TT
A
RD
MI
LL
ER
R
D
MI
LL
ER
R
D
MI
LL
ER
R
D
MI
LL
ER
R
D
MI
LL
ER
R
D
MI
LL
ER
R
D
MI
LL
ER
R
D
MI
LL
ER
R
D
MI
LL
ER
R
D
JA
NE
T D
R
JA
NE
T D
R
JA
NE
T D
R
JA
NE
T D
R
JA
NE
T D
R
JA
NE
T D
R
JA
NE
T D
R
JA
NE
T D
R
JA
NE
T D
R

FLOATING BRIDGE RDFLOATING BRIDGE RDFLOATING BRIDGE RDFLOATING BRIDGE RDFLOATING BRIDGE RDFLOATING BRIDGE RDFLOATING BRIDGE RDFLOATING BRIDGE RDFLOATING BRIDGE RDCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 3CCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCL

AY
TO
N R
D
CL
AY
TO
N R
D
CL
AY
TO
N R
D
CL
AY
TO
N R
D
CL
AY
TO
N R
D
CL
AY
TO
N R
D
CL
AY
TO
N R
D
CL
AY
TO
N R
D
CL
AY
TO
N R
D

CONCESSION RD 11BCONCESSION RD 11BCONCESSION RD 11BCONCESSION RD 11BCONCESSION RD 11BCONCESSION RD 11BCONCESSION RD 11BCONCESSION RD 11BCONCESSION RD 11BMIL

LE
R R
D
MIL
LE
R R
D
MIL
LE
R R
D
MIL
LE
R R
D
MIL
LE
R R
D
MIL
LE
R R
D
MIL
LE
R R
D
MIL
LE
R R
D
MIL
LE
R R
D

CONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 6DCONCESSION RD 7BCONCESSION RD 7BCONCESSION RD 7BCONCESSION RD 7BCONCESSION RD 7BCONCESSION RD 7BCONCESSION RD 7BCONCESSION RD 7BCONCESSION RD 7BOL

D
PE
RT
H
RD
OL
D
PE
RT
H
RD
OL
D
PE
RT
H
RD
OL
D
PE
RT
H
RD
OL
D
PE
RT
H
RD
OL
D
PE
RT
H
RD
OL
D
PE
RT
H
RD
OL
D
PE
RT
H
RD
OL
D
PE
RT
H
RD

CONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SCONCESSION RD 12SQU

AR
RY
RD
QU
AR
RY
RD
QU
AR
RY
RD
QU
AR
RY
RD
QU
AR
RY
RD
QU
AR
RY
RD
QU
AR
RY
RD
QU
AR
RY
RD
QU
AR
RY
RD

GREYSTONE DRGREYSTONE DRGREYSTONE DRGREYSTONE DRGREYSTONE DRGREYSTONE DRGREYSTONE DRGREYSTONE DRGREYSTONE DRCOUNTRY STCOUNTRY STCOUNTRY STCOUNTRY STCOUNTRY STCOUNTRY STCOUNTRY STCOUNTRY STCOUNTRY STSC

OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
SC
OT
CH
CO
RN
ER
S R
D
CO
DE
S L
AN
E
CO
DE
S L
AN
E
CO
DE
S L
AN
E
CO
DE
S L
AN
E
CO
DE
S L
AN
E
CO
DE
S L
AN
E
CO
DE
S L
AN
E
CO
DE
S L
AN
E
CO
DE
S L
AN
E

MCCANN RDMCCANN RDMCCANN RDMCCANN RDMCCANN RDMCCANN RDMCCANN RDMCCANN RDMCCANN RDLIN

E R
D 1
0
LIN
E R
D 1
0
LIN
E R
D 1
0
LIN
E R
D 1
0
LIN
E R
D 1
0
LIN
E R
D 1
0
LIN
E R
D 1
0
LIN
E R
D 1
0
LIN
E R
D 1
0
CO
NC
ES
SIO
N R
D 6
ON
CE
SS
ION
RD
6
ON
CE
SS
ION
RD
6
CO
NC
ES
SIO
N R
D 6
ON
CE
SS
ION
RD
6
CO
NC
ES
SIO
N R
D 6
ON
CE
SS
ION
RD
6
ON
CE
SS
ION
RD
6
ON
CE
SS
ION
RD
6

D 5D 55D55D 5D 55D 5THOMSON SIDERDTHOMSON SIDERDTHOMSON SIDERDTHOMSON SIDERDTHOMSON SIDERDTHOMSON SIDERDTHOMSON SIDERDTHOMSON SIDERDTHOMSON SIDERDPH

EL
AN
S R
D
PH
EL
AN
S R
D
PH
EL
AN
S R
D
PH
EL
AN
S R
D
PH
EL
AN
S R
D
PH
EL
AN
S R
D
PH
EL
AN
S R
D
PH
EL
AN
S R
D
PH
EL
AN
S R
D
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A
CO
NC
ES
SIO
N R
D 1
0A

MILL STMILL STMILL STMILL STMILL STMILL STMILL STMILL STMILL STCO

NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 8
B
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
CO
NC
ES
SIO
N R
D 7
G

RDRDRDGRDRDGRDRDRDRDSTS TSS TS S TS TSS TCO

NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B
CO
NC
ES
SIO
N R
D 5
B

RICHMONDS RDRICHMONDS RDRICHMONDS RDRICHMONDS RDRICHMONDS RDRICHMONDS RDRICHMONDS RDRICHMONDS RDRICHMONDS RDHA

ND
S R
D
HA
ND
S R
D
HA
ND
S R
D
HA
ND
S R
D
HA
ND
S R
D
HA
ND
S R
D
HA
ND
S R
D
HA
ND
S R
D
HA
ND
S R
D
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
CO
NC
ES
SIO
N R
D 1
DO
PS
ON
RD
DO
PS
ON
RD
DO
PS
ON
RD
DO
PS
ON
RD
DO
PS
ON
RD
DO
PS
ON
RD
DO
PS
ON
RD
DO
PS
ON
RD
DO
PS
ON
RD

BURNS RDBURNS RDBURNS RDBURNS RDBURNS RDBURNS RDBURNS RDBURNS RDBURNS RDM

CLACHLIN RDM

CLACHLIN RDM

CLACHLIN RDM

CLACHLIN RDM

CLACHLIN RDM

CLACHLIN RDM

CLACHLIN RDM

CLACHLIN RDM

CLACHLIN RDGLENVIEW RDGLENVIEW RDGLENVIEW RDGLENVIEW RDGLENVIEW RDGLENVIEW RDGLENVIEW RDGLENVIEW RDGLENVIEW RDEBBS BAY RDEBBS BAY RDEBBS BAY RDEBBS BAY RDEBBS BAY RDEBBS BAY RDEBBS BAY RDEBBS BAY RDEBBS BAY RDEB

BS BAY DREB

BS BAY DREB

BS BAY DREB

BS BAY DREB

BS BAY DREB

BS BAY DREB

BS BAY DREB

BS BAY DREB

BS BAY DRTE

NN
YS
ON
R
D
TE
NN
YS
ON
R
D
TE
NN
YS
ON
R
D
TE
NN
YS
ON
R
D
TE
NN
YS
ON
R
D
TE
NN
YS
ON
R
D
TE
NN
YS
ON
R
D
TE
NN
YS
ON
R
D
TE
NN
YS
ON
R
D
7 L
INE
7 L
INE
7 L

INE7 LINE

7 L

INE7 LINE

7 L
INE
7 L
INE
7 L
INE

COLEMAN RDCOLEMAN RDCOLEMAN RDCOLEMAN RDCOLEMAN RDCOLEMAN RDCOLEMAN RDCOLEMAN RDCOLEMAN RD6 L

INE
6 L
INE
6 L

INE6 LINE

6 L

INE6 LINE

6 L
INE
6 L
INE
6 L
INE
8 L
INE
8 L
INE
8 L

INE8 LINE

8 L

INE8 LINE

8 L
INE
8 L
INE
8 L
INE
7 L
INE
7 L
INE
7 L

INE7 LINE

7 L

INE7 LINE

7 L
INE
7 L
INE
7 L
INE
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
O
LD
A
LM
O
NT
E
RD
HAM

ILTON RDHAM

ILTON RDHAM

ILTON RDHAM

ILTON RDHAM

ILTON RDHAM

ILTON RDHAM

ILTON RDHAM

ILTON RDHAM

ILTON RD9 L

INE
9 L
INE
9 L

INE9 LINE

9 L

INE9 LINE

9 L
INE
9 L
INE
9 L
INE

CROOKED SIDE RDCROOKED SIDE RDCROOKED SIDE RDCROOKED SIDE RDCROOKED SIDE RDCROOKED SIDE RDCROOKED SIDE RDCROOKED SIDE RDCROOKED SIDE RDGL

EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD
GL
EN
ES
HT
ON
RD

DERRY SIDE RDDERRY SIDE RDDERRY SIDE RDDERRY SIDE RDDERRY SIDE RDDERRY SIDE RDDERRY SIDE RDDERRY SIDE RDDERRY SIDE RDKID

D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
D
MC
AR
TO
N R
DTU
RN
ER
S R
D
TU
RN
ER
S R
D
TU
RN
ER
S R
D
TU
RN
ER
S R
D
TU
RN
ER
S R
D
TU
RN
ER
S R
D
TU
RN
ER
S R
D
TU
RN
ER
S R
D
TU
RN
ER
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
DO
UG
LA
S R
D
FO
ST
ER
RD
FO
ST
ER
RD
FO
ST
ER
RD
FO
ST
ER
RD
FO
ST
ER
RD
FO
ST
ER
RD
FO
ST
ER
RD
FO
ST
ER
RD
FO
ST
ER
RD

FORD RDFORD RDFORD RDFORD RDFORD RDFORD RDFORD RDFORD RDFORD RDBR

OW
N R
D
BR
OW
N R
D
BR
OW
N R
D
BR
OW
N R
D
BR
OW
N R
D
BR
OW
N R
D
BR
OW
N R
D
BR
OW
N R
D
BR
OW
N R
D

FORD RDFORD RDFORD RDFORD RDFORD RDFORD RDFORD RDFORD RDFORD RDRO

SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
RO
SE
DA
LE
R
D
N
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD
PR
ES
CO
TT
RD

ROSEDALE RD NROSEDALE RD NROSEDALE RD NROSEDALE RD NROSEDALE RD NROSEDALE RD NROSEDALE RD NROSEDALE RD NROSEDALE RD NCO

DE
D
R
CO
DE
D
R
CO
DE
D
R
CO
DE
D
R
CO
DE
D
R
CO
DE
D
R
CO
DE
D
R
CO
DE
D
R
CO
DE
D
R
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
CU
CK
OO
S N
ES
T R
D
FE
RG
US
ON
RD
FE
RG
US
ON
RD
FE
RG
US
ON
RD
FE
RG
US
ON
RD
FE
RG
US
ON
RD
FE
RG
US
ON
RD
FE
RG
US
ON
RD
FE
RG
US
ON
RD
FE
RG
US
ON
RD
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
KID
D R
D
2 L
INE
2 L
INE
2 L

INE2 LINE

2 L

INE2 LINE

2 L
INE
2 L
INE
2 L
INE

BRUNTON SIDE RDBRUNTON SIDE RDBRUNTON SIDE RDBRUNTON SIDE RDBRUNTON SIDE RDBRUNTON SIDE RDBRUNTON SIDE RDBRUNTON SIDE RDBRUNTON SIDE RD2 L

INE
2 L
INE
2 L

INE2 LINE

2 L

INE2 LINE

2 L
INE
2 L
INE
2 L
INE
GU
TH
RI
E R
D
GU
TH
RI
E R
D
GU
TH
RI
E R
D
GU
TH
RI
E R
D
GU
TH
RI
E R
D
GU
TH
RI
E R
D
GU
TH
RI
E R
D
GU
TH
RI
E R
D
GU
TH
RI
E R
D

BUFFAM RDBUFFAM RDBUFFAM RDBUFFAM RDBUFFAM RDBUFFAM RDBUFFAM RDBUFFAM RDBUFFAM RDMC

CR
EA
RD
CC
RE
A R
D
CC
RE
A R
D
MC
CR
EA
RD
CC
RE
A R
D
MC
CR
EA
RD
CC
RE
A R
D
CC
RE
A R
D
CC
RE
A R
D

THOMAS WAY

THOMAS WAY

THOMAS WAY

THOMAS WAY

THOMAS WAY

THOMAS WAY

THOMAS WAY

THOMAS WAY

THOMAS WAY

K
&
P
TR
A
IL
K
&
P
TR
A
IL
K
&
P
TR
A
IL
K
&
P
TR
A
IL
K
&
P
TR
A
IL
K
&
P
TR
A
IL
K
&
P
TR
A
IL
K
&
P
TR
A
IL
K
&
P
TR
A
IL
VA
N E
XA
N R
D
VA
N E
XA
N R
D
VA
N E
XA
N R
D
VA
N E
XA
N R
D
VA
N E
XA
N R
D
VA
N E
XA
N R
D
VA
N E
XA
N R
D
VA
N E
XA
N R
D
VA
N E
XA
N R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D
BE
A
R
IS
L A
ND
R
D

MCCAULEY LAKE RDMCCAULEY LAKE RDMCCAULEY LAKE RDMCCAULEY LAKE RDMCCAULEY LAKE RDMCCAULEY LAKE RDMCCAULEY LAKE RDMCCAULEY LAKE RDMCCAULEY LAKE RDAD

EL
AR
D R
D
AD
EL
AR
D R
D
AD
EL
AR
D R
D
AD
EL
AR
D R
D
AD
EL
AR
D R
D
AD
EL
AR
D R
D
AD
EL
AR
D R
D
AD
EL
AR
D R
D
AD
EL
AR
D R
D

MACKEY CREEK RD

MACKEY CREEK RD

MACKEY CREEK RD

MACKEY CREEK RD

MACKEY CREEK RD

MACKEY CREEK RD

MACKEY CREEK RD

MACKEY CREEK RD

MACKEY CREEK RD

M
AC

KEY CREEK RDM

AC

KEY CREEK RDM

AC

KEY CREEK RDM

AC

KEY CREEK RDM

AC

KEY CREEK RDM

AC

KEY CREEK RDM

AC

KEY CREEK RDM

AC

KEY CREEK RDM

AC

KEY CREEK RDMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEKEAN RDKEAN RDKEAN RDKEAN RDKEAN RDKEAN RDKEAN RDKEAN RDKEAN RDBR

ON
SO
N
RD
BR
ON
SO
N
RD
BR
ON
SO
N
RD
BR
ON
SO
N
RD
BR
ON
SO
N
RD
BR
ON
SO
N
RD
BR
ON
SO
N
RD
BR
ON
SO
N
RD
BR
ON
SO
N
RD

BRONSON RD

BRONSON RD

BRONSON RD

BRONSON RD

BRONSON RD

BRONSON RD

BRONSON RD

BRONSON RD

BRONSON RD

MCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEMCQUESTION LANEO

LD MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D
O

L D MO

O

RE LAKE R

D

BALMERS BAY RDBALMERS BAY RDBALMERS BAY RDBALMERS BAY RDBALMERS BAY RDBALMERS BAY RDBALMERS BAY RDBALMERS BAY RDBALMERS BAY RDMILL YARD RDMILL YARD RDMILL YARD RDMILL YARD RDMILL YARD RDMILL YARD RDMILL YARD RDMILL YARD RDMILL YARD RDCI

RC
LE
R
D
CI
RC
LE
R
D
CI
RC
LE
R
D
CI
RC
LE
R
D
CI
RC
LE
R
D
CI
RC
LE
R
D
CI
RC
LE
R
D
CI
RC
LE
R
D
CI
RC
LE
R
D
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L
PO
I N
T
H
EN
RY
T
RA
I L

RANTZ RDRANTZ RDRANTZ RDRANTZ RDRANTZ RDRANTZ RDRANTZ RDRANTZ RDRANTZ RDTOTALIZE RDTOTALIZE RDTOTALIZE RDTOTALIZE RDTOTALIZE RDTOTALIZE RDTOTALIZE RDTOTALIZE RDTOTALIZE RDTU

CK
ER
RD
TU
CK
ER
RD
TU
CK
ER
RD
TU
CK
ER
RD
TU
CK
ER
RD
TU
CK
ER
RD
TU
CK
ER
RD
TU
CK
ER
RD
TU
CK
ER
RD

RACE HORSE RD

RACE HORSE RD

RACE HORSE RD

RACE HORSE RD

RACE HORSE RD

RACE HORSE RD

RACE HORSE RD

RACE HORSE RD

RACE HORSE RD

CENTRE TRAILCENTRE TRAILCENTRE TRAILCENTRE TRAILCENTRE TRAILCENTRE TRAILCENTRE TRAILCENTRE TRAILCENTRE TRAILRA

CE
HO
R S
E
R D
R A
C E
HO
R S
E
R D
R A
C E
HO
R S
E
R D
R A
C E
HO
R S
E
R D
R A
C E
HO
R S
E
R D
R A
C E
HO
R S
E
R D
R A
C E
HO
R S
E
R D
R A
C E
HO
R S
E
R D
R A
C E
HO
R S
E
R D

BASELINE RDBASELINE RDBASELINE RDBASELINE RDBASELINE RDBASELINE RDBASELINE RDBASELINE RDBASELINE RDRAC

E H
ORS
E R
D
RAC
E H
ORS
E R
D
RAC
E H
ORS
E R
D
RAC
E H
ORS
E R
D
RAC
E H
ORS
E R
D
RAC
E H
ORS
E R
D
RAC
E H
ORS
E R
D
RAC
E H
ORS
E R
D
RAC
E H
ORS
E R
D

RACE HORSE RDRACE HORSE RDRACE HORSE RDRACE HORSE RDRACE HORSE RDRACE HORSE RDRACE HORSE RDRACE HORSE RDRACE HORSE RDRA

C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
RA
C E
HO
R
SE
R
D
W

HITE HORSE RDW

HITE HORSE RDW

HITE HORSE RDW

HITE HORSE RDW

HITE HORSE RDW

HITE HORSE RDW

HITE HORSE RDW

HITE HORSE RDW

HITE HORSE RDVER

ITABLE RD

VER

ITABLE RD

VER

ITABLE RD

VER

ITABLE RD

VER

ITABLE RD

VER

ITABLE RD

VER

ITABLE RD

VER

ITABLE RD

VER

ITABLE RD

TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD
TU
CK
ER
LA
KE
RD

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDDELUTH

IER
RD
DEL
UTH
IER
RD
DEL
UTH
IER
RD
DEL
UTH
IER
RD
DEL
UTH
IER
RD
DEL
UTH
IER
RD
DEL
UTH
IER
RD
DEL
UTH
IER
RD
DEL
UTH
IER
RD

DELUTHIER RD

DELUTHIER RD

DELUTHIER RD

DELUTHIER RD

DELUTHIER RD

DELUTHIER RD

DELUTHIER RD

DELUTHIER RD

DELUTHIER RD

BRINDLE RD

BRINDLE RD

BRINDLE RD

BRINDLE RD

BRINDLE RD

BRINDLE RD

BRINDLE RD

BRINDLE RD

BRINDLE RD

PASSCHENDALE RDPASSCHENDALE RDPASSCHENDALE RDPASSCHENDALE RDPASSCHENDALE RDPASSCHENDALE RDPASSCHENDALE RDPASSCHENDALE RDPASSCHENDALE RDW

AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
W
AS
P
LA
KE
R
D
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD
CA
RT
IER
LA
KE
RD

CARTIER LAKE RDCARTIER LAKE RDCARTIER LAKE RDCARTIER LAKE RDCARTIER LAKE RDCARTIER LAKE RDCARTIER LAKE RDCARTIER LAKE RDCARTIER LAKE RDBLACK DUCK TRAILBLACK DUCK TRAILBLACK DUCK TRAILBLACK DUCK TRAILBLACK DUCK TRAILBLACK DUCK TRAILBLACK DUCK TRAILBLACK DUCK TRAILBLACK DUCK TRAILSURVEY LAKE RDSURVEY LAKE RDSURVEY LAKE RDSURVEY LAKE RDSURVEY LAKE RDSURVEY LAKE RDSURVEY LAKE RDSURVEY LAKE RDSURVEY LAKE RDLANSDOWNE AVELANSDOWNE AVELANSDOWNE AVELANSDOWNE AVELANSDOWNE AVELANSDOWNE AVELANSDOWNE AVELANSDOWNE AVELANSDOWNE AVEMER

TON
ST
MER
TON
ST
MER
TON
ST
MER
TON
ST
MER
TON
ST
MER
TON
ST
MER
TON
ST
MER
TON
ST
MER
TON
ST

LOGGING RDLOGGING RDLOGGING RDLOGGING RDLOGGING RDLOGGING RDLOGGING RDLOGGING RDLOGGING RDDUNNS RDDUNNS RDDUNNS RDDUNNS RDDUNNS RDDUNNS RDDUNNS RDDUNNS RDDUNNS RDMACKENZIE NORTH RDMACKENZIE NORTH RDMACKENZIE NORTH RDMACKENZIE NORTH RDMACKENZIE NORTH RDMACKENZIE NORTH RDMACKENZIE NORTH RDMACKENZIE NORTH RDMACKENZIE NORTH RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDMO

ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
MO
ON
LI
GH
T
BA
Y
RD
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D
AY
LE
N
LA
KE
R
D

GAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDGAFTNEY RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDB

E ECHN UT L AKE RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSTENCELLS RDSHEDHILL RDSHEDHILL RDSHEDHILL RDSHEDHILL RDSHEDHILL RDSHEDHILL RDSHEDHILL RDSHEDHILL RDSHEDHILL RDDEE

R TRAIL RD

DEE

R TRAIL RD

DEE

R TRAIL RD

DEE

R TRAIL RD

DEE

R TRAIL RD

DEE

R TRAIL RD

DEE

R TRAIL RD

DEE

R TRAIL RD

DEE

R TRAIL RD

MENET LAKE RDMENET LAKE RDMENET LAKE RDMENET LAKE RDMENET LAKE RDMENET LAKE RDMENET LAKE RDMENET LAKE RDMENET LAKE RDNORTH RDNORTH RDNORTH RDNORTH RDNORTH RDNORTH RDNORTH RDNORTH RDNORTH RDCA

RT
Y R
D
CA
RT
Y R
D
CA
RT
Y R
D
CA
RT
Y R
D
CA
RT
Y R
D
CA
RT
Y R
D
CA
RT
Y R
D
CA
RT
Y R
D
CA
RT
Y R
D

BLACK POINT RDBLACK POINT RDBLACK POINT RDBLACK POINT RDBLACK POINT RDBLACK POINT RDBLACK POINT RDBLACK POINT RDBLACK POINT RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDCEMENT BRIDGE RDCEMENT BRIDGE RDCEMENT BRIDGE RDCEMENT BRIDGE RDCEMENT BRIDGE RDCEMENT BRIDGE RDCEMENT BRIDGE RDCEMENT BRIDGE RDCEMENT BRIDGE RDSUNNYSIDE RDSUNNYSIDE RDSUNNYSIDE RDSUNNYSIDE RDSUNNYSIDE RDSUNNYSIDE RDSUNNYSIDE RDSUNNYSIDE RDSUNNYSIDE RDKRAFT RDKRAFT RDKRAFT RDKRAFT RDKRAFT RDKRAFT RDKRAFT RDKRAFT RDKRAFT RDCA

ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
CA
ME
LO
T L
AN
E
M

A RTH AS RD

M

A RTH AS RD

M

A RTH AS RD

M

A RTH AS RD

M

A RTH AS RD

M

A RTH AS RD

M

A RTH AS RD

M

A RTH AS RD

M

A RTH AS RD

KELLY LAKE RDKELLY LAKE RDKELLY LAKE RDKELLY LAKE RDKELLY LAKE RDKELLY LAKE RDKELLY LAKE RDKELLY LAKE RDKELLY LAKE RDDE

RIO
NS
RD
DE
RIO
NS
RD
DE
RIO
NS
RD
DE
RIO
NS
RD
DE
RIO
NS
RD
DE
RIO
NS
RD
DE
RIO
NS
RD
DE
RIO
NS
RD
DE
RIO
NS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD
FO
RE
ST
AC
CE
SS
RD

KENNEWAY RDKENNEWAY RDKENNEWAY RDKENNEWAY RDKENNEWAY RDKENNEWAY RDKENNEWAY RDKENNEWAY RDKENNEWAY RDSA UN DE RS RDSA UN DE RS RDSA UN DE RS RDSA UN DE RS RDSA UN DE RS RDSA UN DE RS RDSA UN DE RS RDSA UN DE RS RDSA UN DE RS RDKUL

LY TRAI

L
KUL

LY TRAI

L
KUL

LY TRAI

L
KUL

LY TRAI

L
KUL

LY TRAI

L
KUL

LY TRAI

L
KUL

LY TRAI

L
KUL

LY TRAI

L
KUL

LY TRAI

L TOPPS RDTOPPS RDTOPPS RDTOPPS RDTOPPS RDTOPPS RDTOPPS RDTOPPS RDTOPPS RDWA

PIT
I C
IR
WA
PIT
I C
IR
WA
PIT
I C
IR
WA
PIT
I C
IR
WA
PIT
I C
IR
WA
PIT
I C
IR
WA
PIT
I C
IR
WA
PIT
I C
IR
WA
PIT
I C
IR

AY RDAY RDAY RDAY RDAY RDAY RDAY RDAY RDAY RDTO

N
RD
TO
N
RD
TO
N
RD
TO
N
RD
TO
N
RD
XT
O
N
RD
XT
O
N
RD
XT
O
N
RD
TO
N
RD

GOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDGOOSE LAKE RDSHED HILL RDSHED HILL RDSHED HILL RDSHED HILL RDSHED HILL RDSHED HILL RDSHED HILL RDSHED HILL RDSHED HILL RDSH

ED
H
IL
L
RD
SH
ED
H
IL
L
RD
SH
ED
H
IL
L
RD
SH
ED
H
IL
L
RD
SH
ED
H
IL
L
RD
SH
ED
H
IL
L
RD
SH
ED
H
IL
L
RD
SH
ED
H
IL
L
RD
SH
ED
H
IL
L
RD

BOUDREAU RDBOUDREAU RDBOUDREAU RDBOUDREAU RDBOUDREAU RDBOUDREAU RDBOUDREAU RDBOUDREAU RDBOUDREAU RDJO

SIE LANEJO

SIE LANEJO

SIE LANEJO

SIE LANEJO

SIE LANEJO

SIE LANEJO

SIE LANEJO

SIE LANEJO

SIE LANEW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDW

YLIE RDAKE RDAKE RDAKE RDAKE RDAKE RDAKE RDAKE RDAKE RDAKE RDHTAIL LAKE DRHTAIL LAKE DRHTAIL LAKE DRHTAIL LAKE DRHTAIL LAKE DRSHTAIL LAKE DRSHTAIL LAKE DRSHTAIL LAKE DRHTAIL LAKE DR

SUMCOTT DR

SUMCOTT DR

SUMCOTT DR

SUMCOTT DR

SUMCOTT DR

SUMCOTT DR

SUMCOTT DR

SUMCOTT DR

SUMCOTT DR

M

CKENZIE LAKE RDM

CKENZIE LAKE RDM

CKENZIE LAKE RDM

CKENZIE LAKE RDM

CKENZIE LAKE RDM

CKENZIE LAKE RDM

CKENZIE LAKE RDM

CKENZIE LAKE RDM

CKENZIE LAKE RDHAY LAKE RDHAY LAKE RDHAY LAKE RDHAY LAKE RDHAY LAKE RDHAY LAKE RDHAY LAKE RDHAY LAKE RDHAY LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDM

AJO

R LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILW

HITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILBL

AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD
BL
AC
K
CR
EE
K
RD

FRANCOEUR RDFRANCOEUR RDFRANCOEUR RDFRANCOEUR RDFRANCOEUR RDFRANCOEUR RDFRANCOEUR RDFRANCOEUR RDFRANCOEUR RDBARON CANYON RDBARON CANYON RDBARON CANYON RDBARON CANYON RDBARON CANYON RDBARON CANYON RDBARON CANYON RDBARON CANYON RDBARON CANYON RDBE

EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD
BE
EC
HN
UT
L
AK
E
RD

WYLIE RDWYLIE RDWYLIE RDWYLIE RDWYLIE RDWYLIE RDWYLIE RDWYLIE RDWYLIE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCCAULEY RDMCCAULEY RDMCCAULEY RDMCCAULEY RDMCCAULEY RDMCCAULEY RDMCCAULEY RDMCCAULEY RDMCCAULEY RDM

A JOR LAKE RD

M

A JOR LAKE RD

M

A JOR LAKE RD

M

A JOR LAKE RD

M

A JOR LAKE RD

M

A JOR LAKE RD

M

A JOR LAKE RD

M

A JOR LAKE RD

M

A JOR LAKE RD MAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDBAS

S LAKE RD

BAS

S LAKE RD

BAS

S LAKE RD

BAS

S LAKE RD

BAS

S LAKE RD

BAS

S LAKE RD

BAS

S LAKE RD

BAS

S LAKE RD

BAS

S LAKE RD

MAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDMAJOR LAKE RDEAST STRAGG

LE DREAST STRAGG

LE DREAST STRAGG

LE DREAST STRAGG

LE DREAST STRAGG

LE DREAST STRAGG

LE DREAST STRAGG

LE DREAST STRAGG

LE DREAST STRAGG

LE DRMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDMCKENZIE LAKE RDNO

LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
NO
LA
NS
RD
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D
BU
RC
HIL
L R
D

KAUTH LANEKAUTH LANEKAUTH LANEKAUTH LANEKAUTH LANEKAUTH LANEKAUTH LANEKAUTH LANEKAUTH LANEO

LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
O
LD
H
A
ST
IN
G
S
RD
EG
A
EG
A
EG
A
EG
A
EG
A
EG
A
EG
A
EG
A
EG
A

CLEAR LAKE LANECLEAR LAKE LANECLEAR LAKE LANECLEAR LAKE LANECLEAR LAKE LANECLEAR LAKE LANECLEAR LAKE LANECLEAR LAKE LANECLEAR LAKE LANEPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILPARTRIDGE LAKE TRAILRENATA LANE

RENATA LANE

RENATA LANERENATA LANE

RENATA LANERENATA LANE

RENATA LANE

RENATA LANERENATA LANE

EGAN CREEK TRAILEGAN CREEK TRAILEGAN CREEK TRAILEGAN CREEK TRAILEGAN CREEK TRAILEGAN CREEK TRAILEGAN CREEK TRAILEGAN CREEK TRAILEGAN CREEK TRAILMAYO LAKE RDMAYO LAKE RDMAYO LAKE RDMAYO LAKE RDMAYO LAKE RDMAYO LAKE RDMAYO LAKE RDMAYO LAKE RDMAYO LAKE RDBEST RDBEST RDBEST RDBEST RDBEST RDBEST RDBEST RDBEST RDBEST RDSHIELDS RDSHIELDS RDSHIELDS RDSHIELDS RDSHIELDS RDSHIELDS RDSHIELDS RDSHIELDS RDSHIELDS RDSCO

TT LINE RD

SCO

TT LINE RD

SCO

TT LINE RD

SCO

TT LINE RD

SCO

TT LINE RD

SCO

TT LINE RD

SCO

TT LINE RD

SCO

TT LINE RD

SCO

TT LINE RD

OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
OL
D D
IAM
ON
D L
AK
E R
D
PO
NA
CK
A
RD
PO
NA
CK
A
RD
PO
NA
CK
A
RD
PO
NA
CK
A
RD
PO
NA
CK
A
RD
PO
NA
CK
A
RD
PO
NA
CK
A
RD
PO
NA
CK
A
RD
PO
NA
CK
A

RDFORE

ST

VIEW R

D
FO
RE
ST

VIEW R

D
FO
RE
ST

VIEW R

D
FO
RE
ST

VIEW R

D
FO
RE
ST

VIEW R

D
FO
RE
ST

VIEW R

D
FO
RE
ST

VIEW R

D
FO
RE
ST

VIEW R

D
FO
RE
ST

VIEW R

D
M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

M

ILLIONAIRES WALK

BOWEN RDBOWEN RDBOWEN RDBOWEN RDBOWEN RDBOWEN RDBOWEN RDBOWEN RDBOWEN RDCARR LANECARR LANECARR LANECARR LANECARR LANECARR LANECARR LANECARR LANECARR LANEM

ARINA RDM

ARINA RDM

ARINA RDM

ARINA RDM

ARINA RDM

ARINA RDM

ARINA RDM

ARINA RDM

ARINA RDCEDAR DRCEDAR DRCEDAR DRCEDAR DRCEDAR DRCEDAR DRCEDAR DRCEDAR DRCEDAR DRHOBO LANEHOBO LANEHOBO LANEHOBO LANEHOBO LANEHOBO LANEHOBO LANEHOBO LANEHOBO LANEGLORY RDGLORY RDGLORY RDGLORY RDGLORY RDGLORY RDGLORY RDGLORY RDGLORY RDY RDY RDY RDY RDY RDY RDY RDY RDY RDHAY BAY CRTHAY BAY CRTHAY BAY CRTHAY BAY CRTHAY BAY CRTHAY BAY CRTHAY BAY CRTHAY BAY CRTHAY BAY CRTDOG BAY RDDOG BAY RDDOG BAY RDDOG BAY RDDOG BAY RDDOG BAY RDDOG BAY RDDOG BAY RDDOG BAY RDHOUND LAKE TRAILHOUND LAKE TRAILHOUND LAKE TRAILHOUND LAKE TRAILHOUND LAKE TRAILHOUND LAKE TRAILHOUND LAKE TRAILHOUND LAKE TRAILHOUND LAKE TRAILIR

W
IN
L
AN
E
IR
W
IN
L
AN
E
IR
W
IN
L
AN
E
IR
W
IN
L
AN
E
IR
W
IN
L
AN
E
IR
W
IN
L
AN
E
IR
W
IN
L
AN
E
IR
W
IN
L
AN
E
IR
W
IN
L
AN
E

HERSCHEL FOREST TRAILHERSCHEL FOREST TRAILHERSCHEL FOREST TRAILHERSCHEL FOREST TRAILHERSCHEL FOREST TRAILHERSCHEL FOREST TRAILHERSCHEL FOREST TRAILHERSCHEL FOREST TRAILHERSCHEL FOREST TRAIL MCGARRY RDMCGARRY RDMCGARRY RDMCGARRY RDMCGARRY RDMCGARRY RDMCGARRY RDMCGARRY RDMCGARRY RDOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPOUTLOOK LOOPKERR LANEKERR LANEKERR LANEKERR LANEKERR LANEKERR LANEKERR LANEKERR LANEKERR LANEPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERS O

N RDP ETE RS O

N RDP ETE RS O

N RDP ETE RS O

N RDP ETE RS O

N RDP ETE RS O

N RDP ETE RS O

N RDP ETE RS O

N RDP ETE RS O

N RD PETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDPETERSON RDWIL

LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
WIL
LIA
MS
LAK
E R
D
LA
KE
R
D
E
LA
KE
R
D
E
LA
KE
R
D
E
LA
KE
R
D
E
LA
KE
R
D
E
LA
KE
R
D
E
LA
KE
R
D
E
LA
KE
R
D
E
LA
KE
R
D
E

BAY RIDGE RDBAY RIDGE RDBAY RIDGE RDBAY RIDGE RDBAY RIDGE RDBAY RIDGE RDBAY RIDGE RDBAY RIDGE RDBAY RIDGE RDBUCK HILL RDBUCK HILL RDBUCK HILL RDBUCK HILL RDBUCK HILL RDBUCK HILL RDBUCK HILL RDBUCK HILL RDBUCK HILL RDHILLSIDE RD

HILLSIDE RD

HILLSIDE RD

HILLSIDE RD

HILLSIDE RD

HILLSIDE RD

HILLSIDE RD

HILLSIDE RD

HILLSIDE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

MCD
ONA

LD MINE RD

SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE
SH
EL
DO
N
LA
NE

EAST ROAD LOOPEAST ROAD LOOPEAST ROAD LOOPEAST ROAD LOOPEAST ROAD LOOPEAST ROAD LOOPEAST ROAD LOOPEAST ROAD LOOPEAST ROAD LOOPHILLSVIEW RDHILLSVIEW RDHILLSVIEW RDHILLSVIEW RDHILLSVIEW RDHILLSVIEW RDHILLSVIEW RDHILLSVIEW RDHILLSVIEW RDEA

ST ROAD LOO

P
EA

ST ROAD LOO

P
EA

ST ROAD LOO

P
EA

ST ROAD LOO

P
EA

ST ROAD LOO

P
EA

ST ROAD LOO

P
EA

ST ROAD LOO

P
EA

ST ROAD LOO

P
EA

ST ROAD LOO

P
CH
UR
CH
RD
CH
UR
CH
RD
CH
UR
CH
RD
CH
UR
CH
RD
CH
UR
CH
RD
CH
UR
CH
RD
CH
UR
CH
RD
CH
UR
CH
RD
CH
UR
CH
RD
DAV

IS RD

DAV

IS RD

DAV

IS RD

DAV

IS RD

DAV

IS RD

DAV

IS RD

DAV

IS RD

DAV

IS RD

DAV

IS RD DAVI

S
R
D
DA
VI
S
R
D
DA
VI
S
R
D
DA
VI
S
R
D
DA
VI
S
R
D
DA
VI
S
R
D
DA
VI
S
R
D
DA
VI
S
R
D
DA
VI
S
R
D
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BA
R
K
LA
K
E
RD
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T
BIG
PO
INT
CR
T

PADDY RDPADDY RDPADDY RDPADDY RDPADDY RDPADDY RDPADDY RDPADDY RDPADDY RDHOARES RDHOARES RDHOARES RDHOARES RDHOARES RDHOARES RDHOARES RDHOARES RDHOARES RDWH

ITL
EY
S R
D
WH
ITL
EY
S R
D
WH
ITL
EY
S R
D
WH
ITL
EY
S R
D
WH
ITL
EY
S R
D
WH
ITL
EY
S R
D
WH
ITL
EY
S R
D
WH
ITL
EY
S R
D
WH
ITL
EY
S R
D

VINE LANEVINE LANEVINE LANEVINE LANEVINE LANEVINE LANEVINE LANEVINE LANEVINE LANEECH

O L
AKE
RD
ECH
O L
AKE
RD
ECH
O L
AKE
RD
ECH
O L
AKE
RD
ECH
O L
AKE
RD
ECH
O L
AKE
RD
ECH
O L
AKE
RD
ECH
O L
AKE
RD
ECH
O L
AKE
RD

CENTREVIEW RDCENTREVIEW RDCENTREVIEW RDCENTREVIEW RDCENTREVIEW RDCENTREVIEW RDCENTREVIEW RDCENTREVIEW RDCENTREVIEW RDCENTREVIEW RD

CENTREVIEW RD

CENTREVIEW RD

CENTREVIEW RD

CENTREVIEW RD

CENTREVIEW RD

CENTREVIEW RD

CENTREVIEW RD

CENTREVIEW RD

KAMANISKEG LAKE RDKAMANISKEG LAKE RDKAMANISKEG LAKE RDKAMANISKEG LAKE RDKAMANISKEG LAKE RDKAMANISKEG LAKE RDKAMANISKEG LAKE RDKAMANISKEG LAKE RDKAMANISKEG LAKE RDKEATS LANEKEATS LANEKEATS LANEKEATS LANEKEATS LANEKEATS LANEKEATS LANEKEATS LANEKEATS LANERIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDJESSU P RD

JE SSU P RD

JE SSU P RD

JE SSU P RD

JE SSU P RD

JE SSU P RD

JE SSU P RD

JE SSU P RD

JE SSU P RD

CIRCLE RDCIRCLE RDCIRCLE RDCIRCLE RDCIRCLE RDCIRCLE RDCIRCLE RDCIRCLE RDCIRCLE RDLAK

E ST PETER RD

LAK

E ST PETER RD

LAK

E ST PETER RD

LAK

E ST PETER RD

LAK

E ST PETER RD

LAK

E ST PETER RD

LAK

E ST PETER RD

LAK

E ST PETER RD

LAK

E ST PETER RD

LA

CI AK LA NELA

CI AK LA NELA

CI AK LA NELA

CI AK LA NELA

CI AK LA NELA

CI AK LA NELA

CI AK LA NELA

CI AK LA NELA

CI AK LA NEFERN ST

FERN ST

FERN STFERN ST

FERN STFERN ST

FERN ST

FERN STFERN ST

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D

LA KE ST PE TE R R

D
MIN

K LAKE RD

MIN

K LAKE RD

MIN

K LAKE RD

MIN

K LAKE RD

MIN

K LAKE RD

MIN

K LAKE RD

MIN

K LAKE RD

MIN

K LAKE RD

MIN

K LAKE RD

TEACHERS CIRTEACHERS CIRTEACHERS CIRTEACHERS CIRTEACHERS CIRTEACHERS CIRTEACHERS CIRTEACHERS CIRTEACHERS CIRMINK LAKE RDMINK LAKE RDMINK LAKE RDMINK LAKE RDMINK LAKE RDMINK LAKE RDMINK LAKE RDMINK LAKE RDMINK LAKE RDMINK LAKE RD

MINK LAKE RD

MINK LAKE RD

MINK LAKE RD

MINK LAKE RD

MINK LAKE RD

MINK LAKE RD

MINK LAKE RD

MINK LAKE RD

HICKEY HILL RD

HICKEY HILL RD

HICKEY HILL RD

HICKEY HILL RD

HICKEY HILL RD

HICKEY HILL RD

HICKEY HILL RD

HICKEY HILL RD

HICKEY HILL RD

DEVENISH RDDEVENISH RDDEVENISH RDDEVENISH RDDEVENISH RDDEVENISH RDDEVENISH RDDEVENISH RDDEVENISH RDLAKESHORE DRLAKESHORE DRLAKESHORE DRLAKESHORE DRLAKESHORE DRLAKESHORE DRLAKESHORE DRLAKESHORE DRLAKESHORE DRLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDLITTLE PAPINEAU

LAKE RDMA

DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD
MA
DA
WA
SK
A
RD

CLARKE RDCLARKE RDCLARKE RDCLARKE RDCLARKE RDCLARKE RDCLARKE RDCLARKE RDCLARKE RDPERRIER RD

PERRIER RD

PERRIER RD

PERRIER RD

PERRIER RD

PERRIER RD

PERRIER RD

PERRIER RD

PERRIER RD

W

EBER LANEW

EBER LANEW

EBER LANEW

EBER LANEW

EBER LANEW

EBER LANEW

EBER LANEW

EBER LANEW

EBER LANEDA

M R
D
DA
M R
D
DA
M R
D
DA
M R
D
DA
M R
D
DA
M R
D
DA
M R
D
DA
M R
D
DA
M R
D

SOUTH RDSOUTH RDSOUTH RDSOUTH RDSOUTH RDSOUTH RDSOUTH RDSOUTH RDSOUTH RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDARBOR VITAE RDARBOR VITAE RDARBOR VITAE RDARBOR VITAE RDARBOR VITAE RDARBOR VITAE RDARBOR VITAE RDARBOR VITAE RDARBOR VITAE RDEA

ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA
NE
EA
ST
SID
E T
RO
NT
LA
KE
LA

NE CYBULSKI RDCYBULSKI RDCYBULSKI RDCYBULSKI RDCYBULSKI RDCYBULSKI RDCYBULSKI RDCYBULSKI RDCYBULSKI RDNO

RL OCK RDNO

RL OCK RDNO

RL OCK RDNO

RL OCK RDNO

RL OCK RDNO

RL OCK RDNO

RL OCK RDNO

RL OCK RDNO

RL OCK RDC YBU LSKI RDC YBU LSKI RDC YBU LSKI RDC YBU LSKI RDC YBU LSKI RDC YBU LSKI RDC YBU LSKI RDC YBU LSKI RDC YBU LSKI RDZALUSKA RDZALUSKA RDZALUSKA RDZALUSKA RDZALUSKA RDZALUSKA RDZALUSKA RDZALUSKA RDZALUSKA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDSIBERIA RDYANDRESKI RDYANDRESKI RDYANDRESKI RDYANDRESKI RDYANDRESKI RDYANDRESKI RDYANDRESKI RDYANDRESKI RDYANDRESKI RDCHAPESKI MILL DRCHAPESKI MILL DRCHAPESKI MILL DRCHAPESKI MILL DRCHAPESKI MILL DRCHAPESKI MILL DRCHAPESKI MILL DRCHAPESKI MILL DRCHAPESKI MILL DRPA UG

H L AKE RDPA UG

H L AKE RDPA UG

H L AKE RDPA UG

H L AKE RDPA UG

H L AKE RDPA UG

H L AKE RDPA UG

H L AKE RDPA UG

H L AKE RDPA UG

H L AKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDBRO

TTO
N R
D
BRO
TTO
N R
D
BRO
TTO
N R
D
BRO
TTO
N R
D
BRO
TTO
N R
D
BRO
TTO
N R
D
BRO
TTO
N R
D
BRO
TTO
N R
D
BRO
TTO
N R
D
ETM

ANSKI RDETM

ANSKI RDETM

ANSKI RDETM

ANSKI RDETM

ANSKI RDETM

ANSKI RDETM

ANSKI RDETM

ANSKI RDETM

ANSKI RDW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DRW

ILOWSKI DR WILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRWILOWSKI DRBASIN DEPOT RDBASIN DEPOT RDBASIN DEPOT RDBASIN DEPOT RDBASIN DEPOT RDBASIN DEPOT RDBASIN DEPOT RDBASIN DEPOT RDBASIN DEPOT RDWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILWHITE MOUNTAIN CHUTE TRAILPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDPAUGH LAKE RDWILNO RD NWILNO RD NWILNO RD NWILNO RD NWILNO RD NWILNO RD NWILNO RD NWILNO RD NWILNO RD NW

ILNO RD NW

ILNO RD NW

ILNO RD NW

ILNO RD NW

ILNO RD NW

ILNO RD NW

ILNO RD NW

ILNO RD NW

ILNO RD NWILNO RD NWILNO RD NWILNO RD NWILNO RD N

WILNO RD NWILNO RD NWILNO RD NWILNO RD NWILNO RD NCRANBERRY CREEK RD

CRANBERRY CREEK RD

CRANBERRY CREEK RD

CRANBERRY CREEK RD

CRANBERRY CREEK RD

CRANBERRY CREEK RD

CRANBERRY CREEK RD

CRANBERRY CREEK RD

CRANBERRY CREEK RD

MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD
MU
RA
K F
LIS
RD

KUIACK RD

KUIACK RD

KUIACK RDKUIACK RD

KUIACK RDKUIACK RD

KUIACK RD

KUIACK RDKUIACK RD

VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
VE
R
ET
C
H
RD
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
LE
HO
VI
TC
H
R
D
O

L S HE S K I R DO

L S HE S K I R DO

L S HE S K I R DO

L S HE S K I R DO

L S HE S K I R DO

L S HE S K I R DO

L S HE S K I R DO

L S HE S K I R DO

L S HE S K I R DAM

BRO

SA LANEAM

BRO

SA LANEAM

BRO

SA LANEAM

BRO

SA LANEAM

BRO

SA LANEAM

BRO

SA LANEAM

BRO

SA LANEAM

BRO

SA LANEAM

BRO

SA LANEOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDOPEONGO RDWINDY CITY LANEWINDY CITY LANEWINDY CITY LANEWINDY CITY LANEWINDY CITY LANEWINDY CITY LANEWINDY CITY LANEWINDY CITY LANEWINDY CITY LANEKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDKARTUZY RDW

IGRY RDW

IGRY RDW

IGRY RDW

IGRY RDW

IGRY RDW

IGRY RDW

IGRY RDW

IGRY RDW

IGRY RDLO

ST L ANELO

ST L ANELO

ST L ANELO

ST L ANELO

ST L ANELO

ST L ANELO

ST L ANELO

ST L ANELO

ST L ANEW

ARBLER WAY

W

ARBLER WAY

W

ARBLER WAY

W

ARBLER WAY

W

ARBLER WAY

W

ARBLER WAY

W

ARBLER WAY

W

ARBLER WAY

W

ARBLER WAY

M

CPHEE BAY RDM

CPHEE BAY RDM

CPHEE BAY RDM

CPHEE BAY RDM

CPHEE BAY RDM

CPHEE BAY RDM

CPHEE BAY RDM

CPHEE BAY RDM

CPHEE BAY RDNORTH RDNORTH RDNORTH RDNORTH RD

NORTH RDNORTH RDNORTH RDNORTH RDNORTH RDNONNNONNONNN ANEANEANESM

ITH
RD
SM
ITH
RD
SM
ITH
RD
SM
ITH
RD
SM
ITH
RD
SM
ITH
RD
SM
ITH
RD
SM
ITH
RD
SM
ITH
RD

RDRDRDRD

RDR
D

RDRDRDR

IDG
E L
AN
E
RID
GE
LA
NE
RID
GE
LA
NE
RID
GE
LA
NE
RID
GE
LA
NE
RID
GE
LA
NE
RID
GE
LA
NE
RID
GE
LA
NE
RID
GE
LA
NE
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD

RIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIVER RDRIV

ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD
RIV
ER
RD

SOUTHSIDE LANESOUTHSIDE LANESOUTHSIDE LANESOUTHSIDE LANESOUTHSIDE LANESOUTHSIDE LANESOUTHSIDE LANESOUTHSIDE LANESOUTHSIDE LANEGO

UD
GE
DR
GO
UD
GE
DR
GO
UD
GE
DR
GO
UD
GE
DR
GO
UD
GE
DR
GO
UD
GE
DR
GO
UD
GE
DR
GO
UD
GE
DR
GO
UD
GE
DR
MO
RR
OW
RD
MO
RR
OW
RD
MO
RR
OW
RD
MO
RR
OW
RD
MO
RR
OW
RD
MO
RR
OW
RD
MO
RR
OW
RD
MO
RR
OW
RD
MO
RR
OW
RD

BUTTERBALL LANEBUTTERBALL LANEBUTTERBALL LANEBUTTERBALL LANEBUTTERBALL LANEBUTTERBALL LANEBUTTERBALL LANEBUTTERBALL LANEBUTTERBALL LANEEAST BAY RDEAST BAY RDEAST BAY RDEAST BAY RDEAST BAY RDEAST BAY RDEAST BAY RDEAST BAY RDEAST BAY RDBEACH RD

BEACH RD

BEACH RDBEACH RD

BEACH RDBEACH RD

BEACH RD

BEACH RDBEACH RD

SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
SA
ND
L
AK
E
RD
W

ATERWO

W

ATERWO

W

ATERWO

W

ATERWO

W

ATERWO

W

ATERWO

W

ATERWO

W

ATERWO

W

ATERWO

HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD
HIL
LS
LA
KE
RD

MOUNTAIN RDMOUNTAIN RDMOUNTAIN RDMOUNTAIN RDMOUNTAIN RDMOUNTAIN RDMOUNTAIN RDMOUNTAIN RDMOUNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDM

O

UNTAIN RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDGRINDSTONE LAKE RDKE

RR
LA
NE
KE
RR
LA
NE
KE
RR
LA
NE
KE
RR
LA
NE
KE
RR
LA
NE
KE
RR
LA
NE
KE
RR
LA
NE
KE
RR
LA
NE
KE
RR
LA
NE
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD
MO
UN
TA
IN
RD

BRULE LAKE RDBRULE LAKE RDBRULE LAKE RDBRULE LAKE RDBRULE LAKE RDBRULE LAKE RDBRULE LAKE RDBRULE LAKE RDBRULE LAKE RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDNOR

TH SHOR

E RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDMOUNTAIN CHUTE RDREG

ION

AL RD 16REG

ION

AL RD 16REG

ION

AL RD 16REG

ION

AL RD 16REG

ION

AL RD 16REG

ION

AL RD 16REG

ION

AL RD 16REG

ION

AL RD 16REG

ION

AL RD 16CRUISE RDCRUISE RDCRUISE RDCRUISE RDCRUISE RDCRUISE RDCRUISE RDCRUISE RDCRUISE RDLOG CABIN LANELOG CABIN LANELOG CABIN LANELOG CABIN LANELOG CABIN LANELOG CABIN LANELOG CABIN LANELOG CABIN LANELOG CABIN LANECHATHAM RDCHATHAM RDCHATHAM RDCHATHAM RDCHATHAM RDCHATHAM RDCHATHAM RDCHATHAM RDCHATHAM RDCA

NO
NT
O
R
D
CA
NO
NT
O
R
D
CA
NO
NT
O
R
D
CA
NO
NT
O
R
D
CA
NO
NT
O
R
D
CA
NO
NT
O
R
D
CA
NO
NT
O
R
D
CA
NO
NT
O
R
D
CA
NO
NT
O
R
D
W

I LSON

H

ILL D RW

I LSON

H

ILL D RW

I LSON

H

ILL D RW

I LSON

H

ILL D RW

I LSON

H

ILL D RW

I LSON

H

ILL D RW

I LSON

H

ILL D RW

I LSON

H

ILL D RW

I LSON

H

ILL D RNO

RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN
E
NO
RT
H
SH
OR
E
ES
TA
TE
S L
AN

E PETERS LANEPETERS LANEPETERS LANEPETERS LANEPETERS LANEPETERS LANEPETERS LANEPETERS LANEPETERS LANEDO

YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

DO
YLE
MO
UN
TA

IN RD

O'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RDO'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

O'GRADY SETTLEMENT RD

MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W R
D
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W
RD
MO
UN
TA
IN
VIE
W

RD MOUNTA

IN VIEW RD

MOU
NTA

IN VIEW RD

MOU
NTA

IN VIEW RD

MOU
NTA

IN VIEW RD

MOU
NTA

IN VIEW RD

MOU
NTA

IN VIEW RD

MOU
NTA

IN VIEW RD

MOU
NTA

IN VIEW RD

MOU
NTA

IN VIEW RD

RUS
SEL

L RDRUS

SEL

L RDRUS

SEL

L RDRUS

SEL

L RDRUS

SEL

L RDRUS

SEL

L RDRUS

SEL

L RDRUS

SEL

L RDRUS

SEL

L RDGREENS RDGREENS RDGREENS RDGREENS RDGREENS RDGREENS RDGREENS RDGREENS RDGREENS RDGORMAN RDGORMAN RDGORMAN RDGORMAN RDGORMAN RDGORMAN RDGORMAN RDGORMAN RDGORMAN RDROCHEFORT RD

ROC

HEFORT RD

ROC

HEFORT RD

ROC

HEFORT RD

ROC

HEFORT RD

ROC

HEFORT RD

ROC

HEFORT RD

ROC

HEFORT RD

ROC

HEFORT RD

RUBY RDRUBY RDRUBY RDRUBY RDRUBY RDRUBY RDRUBY RDRUBY RDRUBY RDKING STKING STKING STKING STKING STKING STKING STKING STKING STWILDLIFE RD

WILDLIFE RD

WILDLIFE RD

WILDLIFE RD

WILDLIFE RD

WILDLIFE RD

WILDLIFE RD

WILDLIFE RD

WILDLIFE RD

SIM

PSON PIT RDSIM

PSON PIT RDSIM

PSON PIT RDSIM

PSON PIT RDSIM

PSON PIT RDSIM

PSON PIT RDSIM

PSON PIT RDSIM

PSON PIT RDSIM

PSON PIT RDMAS

K RDMAS

K RDMAS

K RDMASK RDMAS

K RDMASK RDMAS

K RDMAS

K RDMASK RDRO

ZE
K
RD
RO
ZE
K
RD
RO
ZE
K
RD
RO
ZE
K
RD
RO
ZE
K
RD
RO
ZE
K
RD
RO
ZE
K
RD
RO
ZE
K
RD
RO
ZE
K
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK
RD
BY
ER
S C
RE
EK

RDBUCK

HI
LL
RD
BU
CK
HI
LL
RD
BU
CK
HI
LL
RD
BU
CK
HI
LL
RD
BU
CK
HI
LL
RD
BU
CK
HI
LL
RD
BU
CK
HI
LL
RD
BU
CK
HI
LL
RD
BU
CK
HI
LL
RD

HORSE SHOE RDHORSE SHOE RDHORSE SHOE RDHORSE SHOE RDHORSE SHOE RDHORSE SHOE RDHORSE SHOE RDHORSE SHOE RDHORSE SHOE RDSUN

RISE RD

SUN

RISE RD

SUN

RISE RD

SUN

RISE RD

SUN

RISE RD

SUN

RISE RD

SUN

RISE RD

SUN

RISE RD

SUN

RISE RD SAND B AY L A NES A

N D B AY L A NES A

N D B AY L A NES A

N D B AY L A NES A

N D B AY L A NES A

N D B AY L A NES A

N D B AY L A NES A

N D B AY L A NES A

N D B AY L A NETURNERS RDTURNERS RDTURNERS RDTURNERS RDTURNERS RDTURNERS RDTURNERS RDTURNERS RDTURNERS RDHILTS LANEHILTS LANEHILTS LANEHILTS LANEHILTS LANEHILTS LANEHILTS LANEHILTS LANEHILTS LANE

MAS

K RDMAS

K RDMAS

K RDMASK RDMAS

K RDMASK RDMAS

K RDMAS

K RDMASK RDB

O
LY
E
LA
N
E
B
O
LY
E
LA
N
E
B
O
LY
E
LA
N
E
B
O
LY
E
LA
N
E
B
O
LY
E
LA
N
E
B
O
LY
E
LA
N
E
B
O
LY
E
LA
N
E
B
O
LY
E
LA
N
E
B
O
LY
E
LA
N
E

RE D ROCK RDRE D ROCK RDRE D ROCK RDRE D ROCK RDRE D ROCK RDRE D ROCK RDRE D ROCK RDRE D ROCK RDRE D ROCK RDGUNNS RDGUNNS RDGUNNS RDGUNNS RDGUNNS RDGUNNS RDGUNNS RDGUNNS RDGUNNS RDOL

D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
OL
D
TR
ES
TL
E R
D
STA

CK RD

STA

CK RD

STA

CK RD

STA

CK RD

STA

CK RD

STA

CK RD

STA

CK RD

STA

CK RD

STA

CK RD

TO
W
ER
R
D
TO
W
ER
R
D
TO
W
ER
R
D
TO
W
ER
R
D
TO
W
ER
R
D
TO
W
ER
R
D
TO
W
ER
R
D
TO
W
ER
R
D
TO
W
ER
R

D LITT

LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD
LI
TT
LE
F
IN
CH
L
AK
E
RD

BUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDBUCKSHOT LAKE RDSN

ID
ER
R
D
SN
ID
ER
R
D
SN
ID
ER
R
D
SN
ID
ER
R
D
SN
ID
ER
R
D
SN
ID
ER
R
D
SN
ID
ER
R
D
SN
ID
ER
R
D
SN
ID
ER
R
D

TERRYS LANETERRYS LANETERRYS LANETERRYS LANETERRYS LANETERRYS LANETERRYS LANETERRYS LANETERRYS LANEASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDASHBY RDMYRTLE RDMYRTLE RDMYRTLE RDMYRTLE RDMYRTLE RDMYRTLE RDMYRTLE RDMYRTLE RDMYRTLE RDSLA

TE FALL

S R
D
SLA

TE FALL

S R
D
SLA

TE FALL

S R
D
SLA

TE FALL

S R
D
SLA

TE FALL

S R
D
SLA

TE FALL

S R
D
SLA

TE FALL

S R
D
SLA

TE FALL

S R
D
SLA

TE FALL

S R
D
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD
CLE
AR
LA
KE
RD

SPECTACLE LAKE RDSPECTACLE LAKE RDSPECTACLE LAKE RDSPECTACLE LAKE RDSPECTACLE LAKE RDSPECTACLE LAKE RDSPECTACLE LAKE RDSPECTACLE LAKE RDSPECTACLE LAKE RDMUMFORD RDMUMFORD RDMUMFORD RDMUMFORD RDMUMFORD RDMUMFORD RDMUMFORD RDMUMFORD RDMUMFORD RDCLEAR LAKE RD

CLEAR LAKE RD

CLEAR LAKE RD

CLEAR LAKE RD

CLEAR LAKE RD

CLEAR LAKE RD

CLEAR LAKE RD

CLEAR LAKE RD

CLEAR LAKE RD

TOW

NLINE RDTOW

NLINE RDTOW

NLINE RDTOW

NLINE RDTOW

NLINE RDTOW

NLINE RDTOW

NLINE RDTOW

NLINE RDTOW

NLINE RDWEST LINE

WEST LINE

WEST LINEWEST LINE

WEST LINEWEST LINE

WEST LINE

WEST LINEWEST LINE

WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
WE
ST
EE
LS
LA
KE
R
D
DY
NO
R
D
DY
NO
R
D
DY
NO
R
D
DY
NO
R
D
DY
NO
R
D
DY
NO
R
D
DY
NO
R
D
DY
NO
R
D
DY
NO
R
D
D
YNO
RD
D
YNO
RD
D
YNO
RD
D
YNO
RD
D
YNO
RD
D
YNO
RD
D
YNO
RD
D
YNO
RD
D
YNO
RD

5 RD5 RD5 RD5 RD5 RD5 RD5 RD5 RD5 RDMC

ISA
AC
DR
MC
ISA
AC
DR
MC
ISA
AC
DR
MC
ISA
AC
DR
MC
ISA
AC
DR
MC
ISA
AC
DR
MC
ISA
AC
DR
MC
ISA
AC
DR
MC
ISA
AC
DR
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D
BIS
SE
TT
C
RE
EK
R
D

BISSETT CREEK RDBISSETT CREEK RDBISSETT CREEK RDBISSETT CREEK RDBISSETT CREEK RDBISSETT CREEK RDBISSETT CREEK RDBISSETT CREEK RDBISSETT CREEK RDBI

SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
E E
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD
BI
SS
ET
T
CR
EE
K
RD

SUNRICH LANESUNRICH LANESUNRICH LANESUNRICH LANESUNRICH LANESUNRICH LANESUNRICH LANESUNRICH LANESUNRICH LANERE

D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L
RE
D
FO
X
T R
A
I L

DRIFTWOOD PARK RDDRIFTWOOD PARK RDDRIFTWOOD PARK RDDRIFTWOOD PARK RDDRIFTWOOD PARK RDDRIFTWOOD PARK RDDRIFTWOOD PARK RDDRIFTWOOD PARK RDDRIFTWOOD PARK RDBOY SCOUT TRAILBOY SCOUT TRAILBOY SCOUT TRAILBOY SCOUT TRAILBOY SCOUT TRAILBOY SCOUT TRAILBOY SCOUT TRAILBOY SCOUT TRAILBOY SCOUT TRAILEDG

EW

ATER WAY

EDG
EW

ATER WAY

EDG
EW

ATER WAY

EDG
EW

ATER WAY

EDG
EW

ATER WAY

EDG
EW

ATER WAY

EDG
EW

ATER WAY

EDG
EW

ATER WAY

EDG
EW

ATER WAY

MACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDMACKEY CREEK RDBE

SS
EM
ER
R
D
BE
SS
EM
ER
R
D
BE
SS
EM
ER
R
D
BE
SS
EM
ER
R
D
BE
SS
EM
ER
R
D
BE
SS
EM
ER
R
D
BE
SS
EM
ER
R
D
BE
SS
EM
ER
R
D
BE
SS
EM
ER
R
D

FOSTER LAKE RDFOSTER LAKE RDFOSTER LAKE RDFOSTER LAKE RDFOSTER LAKE RDFOSTER LAKE RDFOSTER LAKE RDFOSTER LAKE RDFOSTER LAKE RDBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEBESSEMER LANEMCCAW RDMCCAW RDMCCAW RDMCCAW RDMCCAW RDMCCAW RDMCCAW RDMCCAW RDMCCAW RDSOUTH LANESOUTH LANESOUTH LANESOUTH LANESOUTH LANESOUTH LANESOUTH LANESOUTH LANESOUTH LANEW

ANNAMAKER LANEW

ANNAMAKER LANEW

ANNAMAKER LANEW

ANNAMAKER LANEW

ANNAMAKER LANEW

ANNAMAKER LANEW

ANNAMAKER LANEW

ANNAMAKER LANEW

ANNAMAKER LANECOT

TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

COT
TAG

E LANE

BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
BR
AD
LE
Y
LA
NE
G

IN LA KE R

D
G

IN LA KE R

D
G

IN LA KE R

D
G

IN LA KE R

D
G

IN LA KE R

D
G

IN LA KE R

D
G

IN LA KE R

D
G

IN LA KE R

D
G

IN LA KE R

D
FO

RT STEWART RDFO

RT STEWART RDFO

RT STEWART RDFO

RT STEWART RDFO

RT STEWART RDFO

RT STEWART RDFO

RT STEWART RDFO

RT STEWART RDFO

RT STEWART RDMCP

HER
SON
RD
MCP
HER
SON
RD
MCP
HER
SON
RD
MCP
HER
SON
RD
MCP
HER
SON
RD
MCP
HER
SON
RD
MCP
HER
SON
RD
MCP
HER
SON
RD
MCP
HER
SON
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
PE
AC
OC
K
RD
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT
M
AL
LA
RD
C
RT

MALLARD LAKE RD

MALLARD LAKE RD

MALLARD LAKE RD

MALLARD LAKE RD

MALLARD LAKE RD

MALLARD LAKE RD

MALLARD LAKE RD

MALLARD LAKE RD

MALLARD LAKE RD

TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E
TH
AE
TE
R
L A
N
E

WHYTES RDWHYTES RDWHYTES RDWHYTES RDWHYTES RDWHYTES RDWHYTES RDWHYTES RDWHYTES RDA. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON

RD

A. GUY WILSON RDA. GUY WILSON RDA. GUY WILSON RDA. GUY WILSON RDA. GUY WILSON RDA. GUY WILSON RDA. GUY WILSON RDA. GUY WILSON RDA. GUY WILSON RDSTEWART RDSTEWART RDSTEWART RDSTEWART RDSTEWART RDSTEWART RDSTEWART RDSTEWART RDSTEWART RDTR

AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
D
TR
AI
LS
E
ND
R
DPA
RK
R
D
PA
RK
R
D
PA
RK
R
D
PA
RK
R
D
PA
RK
R
D
PA
RK
R
D
PA
RK
R
D
PA
RK
R
D
PA
RK
R
D

BURGESS RDBURGESS RDBURGESS RDBURGESS RDBURGESS RDBURGESS RDBURGESS RDBURGESS RDBURGESS RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDLO

W

ER FARAD AY RDSID

DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
SID
DO
N L
AK
E P
L
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
R
A B
B
I T
T
R A
IL
R
D
TRO

UT LAKE RDTRO

UT LAKE RDTRO

UT LAKE RDTRO

UT LAKE RDTRO

UT LAKE RDTRO

UT LAKE RDTRO

UT LAKE RDTRO

UT LAKE RDTRO

UT LAKE RDBOO

TH LANEBOO

TH LANEBOO

TH LANEBOO

TH LANEBOO

TH LANEBOO

TH LANEBOO

TH LANEBOO

TH LANEBOO

TH LANELYMAN RDLYMAN RDLYMAN RDLYMAN RDLYMAN RDLYMAN RDLYMAN RDLYMAN RDLYMAN RDMO

NC
K R
D
MO
NC
K R
D
MO
NC
K R
D
MO
NC
K R
D
MO
NC
K R
D
MO
NC
K R
D
MO
NC
K R
D
MO
NC
K R
D
MO
NC
K R
D
CR
OS
S R
D
CR
OS
S R
D
CR
OS
S R
D
CR
OS
S R
D
CR
OS
S R
D
CR
OS
S R
D
CR
OS
S R
D
CR
OS
S R
D
CR
OS
S R
D
MO
NC
K
RD
MO
NC
K
RD
MO
NC
K
RD
MO
NC
K
RD
MO
NC
K
RD
MO
NC
K
RD
MO
NC
K
RD
MO
NC
K
RD
MO
NC
K
RD
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
A
LB
IO
N
CR
T
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D
LO
W
ER
F
AR
AD
AY
R
D

CLELAND CRTCLELAND CRTCLELAND CRTCLELAND CRTCLELAND CRTCLELAND CRTCLELAND CRTCLELAND CRTCLELAND CRTPORCUPINE LANEPORCUPINE LANEPORCUPINE LANEPORCUPINE LANEPORCUPINE LANEPORCUPINE LANEPORCUPINE LANEPORCUPINE LANEPORCUPINE LANEM

ERTZ LANEM

ERTZ LANEM

ERTZ LANEM

ERTZ LANEM

ERTZ LANEM

ERTZ LANEM

ERTZ LANEM

ERTZ LANEM

ERTZ LANEST

RIN
GE
R D
R
ST
RIN
GE
R D
R
ST
RIN
GE
R D
R
ST
RIN
GE
R D
R
ST
RIN
GE
R D
R
ST
RIN
GE
R D
R
ST
RIN
GE
R D
R
ST
RIN
GE
R D
R
ST
RIN
GE
R D
R
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
RO
CK
L
AK
E
CR
ES
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BA
Y
L A
KE
R
D
BR
O
W
N
PL
BR
O
W
N
PL
BR
O
W
N
PL
BR
O
W
N
PL
BR
O
W
N
PL
BR
O
W
N
PL
BR
O
W
N
PL
BR
O
W
N
PL
BR
O
W
N
PL
M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

M
AXW

EL L S ET TLE ME NT RD

CHEMAUSHGON RDCHEMAUSHGON RDCHEMAUSHGON RDCHEMAUSHGON RDCHEMAUSHGON RDCHEMAUSHGON RDCHEMAUSHGON RDCHEMAUSHGON RDCHEMAUSHGON RDBATTELLE RDBATTELLE RDBATTELLE RDBATTELLE RDBATTELLE RDBATTELLE RDBATTELLE RDBATTELLE RDBATTELLE RD

TAIT LANETAIT LANETAIT LANETAIT LANETAIT LANETAIT LANETAIT LANETAIT LANETAIT LANEOLD HASTINGS RDOLD HASTINGS RDOLD HASTINGS RDOLD HASTINGS RDOLD HASTINGS RDOLD HASTINGS RDOLD HASTINGS RDOLD HASTINGS RDOLD HASTINGS RDG

RA
F
R D
G
RA
F
R D
G
RA
F
R D
G
RA
F
R D
G
RA
F
R D
G
RA
F
R D
G
RA
F
R D
G
RA
F
R D
G
RA
F
R D

COLBOURNE RDCOLBOURNE RDCOLBOURNE RDCOLBOURNE RDCOLBOURNE RDCOLBOURNE RDCOLBOURNE RDCOLBOURNE RDCOLBOURNE RDDE

TL
OR
RD
DE
TL
OR
RD
DE
TL
OR
RD
DE
TL
OR
RD
DE
TL
OR
RD
DE
TL
OR
RD
DE
TL
OR
RD
DE
TL
OR
RD
DE
TL
OR
RD

SPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILSPRUCE LAKE TRAILLAL

AND
E R
D
LAL
AND
E R
D
LAL
AND
E R
D
LAL
AND
E R
D
LAL
AND
E R
D
LAL
AND
E R
D
LAL
AND
E R
D
LAL
AND
E R
D
LAL
AND
E R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
GE
NR
IC
KS
R
D
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
BU
RN
T B
RID
GE
RD
B

URNT BRIDGE RDB

URNT BRIDGE RDB

URNT BRIDGE RDB

URNT BRIDGE RDB

URNT BRIDGE RDB

URNT BRIDGE RDB

URNT BRIDGE RDB

URNT BRIDGE RDB

URNT BRIDGE RDBUR

NT BRID

GE RD

BUR

NT BRID

GE RD

BUR

NT BRID

GE RD

BUR

NT BRID

GE RD

BUR

NT BRID

GE RD

BUR

NT BRID

GE RD

BUR

NT BRID

GE RD

BUR

NT BRID

GE RD

BUR

NT BRID

GE RD

OSCAR BOEHME RD

OSCAR BOEHME RD

OSCAR BOEHME RD

OSCAR BOEHME RD

OSCAR BOEHME RD

OSCAR BOEHME RD

OSCAR BOEHME RD

OSCAR BOEHME RD

OSCAR BOEHME RD

RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
RE
G
IO
NA
L
RD
5
17
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD
M
O
R
A S
S I
N
L
AK
E
RD

WISHMAN RDWISHMAN RDWISHMAN RDWISHMAN RDWISHMAN RDWISHMAN RDWISHMAN RDWISHMAN RDWISHMAN RDHY

LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D
HY
LA
ND
C
RE
EK
R
D

HYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDHYLAND CREEK RDKA

RG
US
R
D
KA
RG
US
R
D
KA
RG
US
R
D
KA
RG
US
R
D
KA
RG
US
R
D
KA
RG
US
R
D
KA
RG
US
R
D
KA
RG
US
R
D
KA
RG
US
R
D

ADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDADDINGTON RDCAM

ERO

N LAKE RD

CAM
ERO

N LAKE RD

CAM
ERO

N LAKE RD

CAM
ERO

N LAKE RD

CAM
ERO

N LAKE RD

CAM
ERO

N LAKE RD

CAM
ERO

N LAKE RD

CAM
ERO

N LAKE RD

CAM
ERO

N LAKE RD

HOLLANDS LANEHOLLANDS LANEHOLLANDS LANEHOLLANDS LANEHOLLANDS LANEHOLLANDS LANEHOLLANDS LANEHOLLANDS LANEHOLLANDS LANEG

UINEY RDG

UINEY RDG

UINEY RDG

UINEY RDG

UINEY RDG

UINEY RDG

UINEY RDG

UINEY RDG

UINEY RDLETTERKENNY RDLETTERKENNY RDLETTERKENNY RDLETTERKENNY RDLETTERKENNY RDLETTERKENNY RDLETTERKENNY RDLETTERKENNY RDLETTERKENNY RDSCH

IMMENS RD

SCH

IMMENS RD

SCH

IMMENS RD

SCH

IMMENS RD

SCH

IMMENS RD

SCH

IMMENS RD

SCH

IMMENS RD

SCH

IMMENS RD

SCH

IMMENS RD

KINDERS LANEKINDERS LANEKINDERS LANEKINDERS LANEKINDERS LANEKINDERS LANEKINDERS LANEKINDERS LANEKINDERS LANEWELKS RDWELKS RDWELKS RDWELKS RDWELKS RDWELKS RDWELKS RDWELKS RDWELKS RDKAUFFELDT RDKAUFFELDT RDKAUFFELDT RDKAUFFELDT RDKAUFFELDT RDKAUFFELDT RDKAUFFELDT RDKAUFFELDT RDKAUFFELDT RDSI

LA
S
LA
NE
SI
LA
S
LA
NE
SI
LA
S
LA
NE
SI
LA
S
LA
NE
SI
LA
S
LA
NE
SI
LA
S
LA
NE
SI
LA
S
LA
NE
SI
LA
S
LA
NE
SI
LA
S
LA
NE

JOHN WATSON RDJOHN WATSON RDJOHN WATSON RDJOHN WATSON RDJOHN WATSON RDJOHN WATSON RDJOHN WATSON RDJOHN WATSON RDJOHN WATSON RDNO

LA
N
RD
NO
LA
N
RD
NO
LA
N
RD
NO
LA
N
RD
NO
LA
N
RD
NO
LA
N
RD
NO
LA
N
RD
NO
LA
N
RD
NO
LA
N
RD
HUB
ERS
RD
HUB
ERS
RD
HUB
ERS
RD
HUB
ERS
RD
HUB
ERS
RD
HUB
ERS
RD
HUB
ERS
RD
HUB
ERS
RD
HUB
ERS
RD
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D
FI
NN
ER
TY
R
D

CORMAC RDCORMAC RDCORMAC RDCORMAC RDCORMAC RDCORMAC RDCORMAC RDCORMAC RDCORMAC RDBEG

GAN RDBEG

GAN RDBEG

GAN RDBEG

GAN RDBEG

GAN RDBEG

GAN RDBEG

GAN RDBEG

GAN RDBEG

GAN RDELW

OOD

S RDELW

OOD

S RDELW

OOD

S RDELW

OOD

S RDELW

OOD

S RDELW

OOD

S RDELW

OOD

S RDELW

OOD

S RDELW

OOD

S RDFRENCH LINE RDFRENCH LINE RDFRENCH LINE RDFRENCH LINE RDFRENCH LINE RDFRENCH LINE RDFRENCH LINE RDFRENCH LINE RDFRENCH LINE RDHICKS RDHICKS RDHICKS RDHICKS RDHICKS RDHICKS RDHICKS RDHICKS RDHICKS RDWAS

MUN

D RDWAS

MUN

D RDWAS

MUN

D RDWAS

MUN

D RDWAS

MUN

D RDWAS

MUN

D RDWAS

MUN

D RDWAS

MUN

D RDWAS

MUN

D RDM

ISSIPPI RDM

ISSIPPI RDM

ISSIPPI RDM

ISSIPPI RDM

ISSIPPI RDM

ISSIPPI RDM

ISSIPPI RDM

ISSIPPI RDM

ISSIPPI RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDLORWALL LAKE RDSLA

TE FALLS RDSLA

TE FALLS RDSLA

TE FALLS RDSLA

TE FALLS RDSLA

TE FALLS RDSLA

TE FALLS RDSLA

TE FALLS RDSLA

TE FALLS RDSLA

TE FALLS RDJARDIN LANEJARDIN LANEJARDIN LANEJARDIN LANEJARDIN LANEJARDIN LANEJARDIN LANEJARDIN LANEJARDIN LANEPAUDASH LAKE RDPAUDASH LAKE RDPAUDASH LAKE RDPAUDASH LAKE RDPAUDASH LAKE RDPAUDASH LAKE RDPAUDASH LAKE RDPAUDASH LAKE RDPAUDASH LAKE RDMANHIRE DRMANHIRE DRMANHIRE DRMANHIRE DRMANHIRE DRMANHIRE DRMANHIRE DRMANHIRE DRMANHIRE DRKE

NN
Y
RD
KE
NN
Y
RD
KE
NN
Y
RD
KE
NN
Y
RD
KE
NN
Y
RD
KE
NN
Y
RD
KE
NN
Y
RD
KE
NN
Y
RD
KE
NN
Y
RD

MCDIARMID SIDE RDMCDIARMID SIDE RDMCDIARMID SIDE RDMCDIARMID SIDE RDMCDIARMID SIDE RDMCDIARMID SIDE RDMCDIARMID SIDE RDMCDIARMID SIDE RDMCDIARMID SIDE RDSH

IRL
EY
RD
SH
IRL
EY
RD
SH
IRL
EY
RD
SH
IRL
EY
RD
SH
IRL
EY
RD
SH
IRL
EY
RD
SH
IRL
EY
RD
SH
IRL
EY
RD
SH
IRL
EY
RD

BROWN SIDE RD

BROWN SIDE RD

BROWN SIDE RD

BROWN SIDE RD

BROWN SIDE RD

BROWN SIDE RD

BROWN SIDE RD

BROWN SIDE RD

BROWN SIDE RD

1 A
VE
1 A
VE
1 A

VE1 AVE

1 A

VE1 AVE

1 A
VE
1 A
VE
1 A
VE
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
6 L
INE
BE
CK
WI
TH
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
SH
EL
BY
LA
NE
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
RA
NG
ER
CA
MP
RD
AIR
PO
RT
RD
AIR
PO
RT
RD
AIR
PO
RT
RD
AIR
PO
RT
RD
AIR
PO
RT
RD
AIR
PO
RT
RD
AIR
PO
RT
RD
AIR
PO
RT
RD
AIR
PO
RT
RD

SHAWMORR LANESHAWMORR LANESHAWMORR LANESHAWMORR LANESHAWMORR LANESHAWMORR LANESHAWMORR LANESHAWMORR LANESHAWMORR LANELAKESIDE RDLAKESIDE RDLAKESIDE RDLAKESIDE RDLAKESIDE RDLAKESIDE RDLAKESIDE RDLAKESIDE RDLAKESIDE RD

CONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BCONCESSION RD 5BST

ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D
ST
ON
EY
LO
NE
SO
ME
R
D

LAKESHORE RDLAKESHORE RDLAKESHORE RDLAKESHORE RDLAKESHORE RDLAKESHORE RDLAKESHORE RDLAKESHORE RDLAKESHORE RDLOVES GATELOVES GATELOVES GATELOVES GATELOVES GATELOVES GATELOVES GATELOVES GATELOVES GATECONCESSION RD 3BCONCESSION RD 3BCONCESSION RD 3BCONCESSION RD 3BCONCESSION RD 3BCONCESSION RD 3BCONCESSION RD 3BCONCESSION RD 3BCONCESSION RD 3BBOW LAKE LANEBOW LAKE LANEBOW LAKE LANEBOW LAKE LANEBOW LAKE LANEBOW LAKE LANEBOW LAKE LANEBOW LAKE LANEBOW LAKE LANEFO

LG
ER
R
D
FO
LG
ER
R
D
FO
LG
ER
R
D
FO
LG
ER
R
D
FO
LG
ER
R
D
FO
LG
ER
R
D
FO
LG
ER
R
D
FO
LG
ER
R
D
FO
LG
ER
R
D

PETERSONS RDPETERSONS RDPETERSONS RDPETERSONS RDPETERSONS RDPETERSONS RDPETERSONS RDPETERSONS RDPETERSONS RDGEM

MIL
LS
RD
GEM
MIL
LS
RD
GEM
MIL
LS
RD
GEM
MIL
LS
RD
GEM
MIL
LS
RD
GEM
MIL
LS
RD
GEM
MIL
LS
RD
GEM
MIL
LS
RD
GEM
MIL
LS
RD

HIGH FALLS RDHIGH FALLS RDHIGH FALLS RDHIGH FALLS RD

HIGH FALLS RDHIGH FALLS RDHIGH FALLS RDHIGH FALLS RDHIGH FALLS RDBLU

E H
ER
ON
RD
BLU
E H
ER
ON
RD
BLU
E H
ER
ON
RD
BLU
E H
ER
ON
RD
BLU
E H
ER
ON
RD
BLU
E H
ER
ON
RD
BLU
E H
ER
ON
RD
BLU
E H
ER
ON
RD
BLU
E H
ER
ON
RD

MARCONI AVEMARCONI AVEMARCONI AVEMARCONI AVEMARCONI AVEMARCONI AVEMARCONI AVEMARCONI AVEMARCONI AVEED

IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
ED
IT
H
M
AR
G
AR
ET
P
L
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R
TE
RR
AC
E R
IDG
E D
R

BRIDGESTONE DRBRIDGESTONE DRBRIDGESTONE DRBRIDGESTONE DRBRIDGESTONE DRBRIDGESTONE DRBRIDGESTONE DRBRIDGESTONE DRBRIDGESTONE DRLA VA NT MIL L R DLA VA NT MIL L R DLA VA NT MIL L R DLA VA NT MIL L R DLA VA NT MIL L R DLA VA NT MIL L R DLA VA NT MIL L R DLA VA NT MIL L R DLA VA NT MIL L R DCONCESSION RD 1CONCESSION RD 1CONCESSION RD 1CONCESSION RD 1CONCESSION RD 1CONCESSION RD 1CONCESSION RD 1CONCESSION RD 1CONCESSION RD 12 LINE RD2 LINE RD2 LINE RD2 LINE RD2 LINE RD2 LINE RD2 LINE RD2 LINE RD2 LINE RDDE

W
O
LF
E
ST
DE
W
O
LF
E
ST
DE
W
O
LF
E
ST
DE
W
O
LF
E
ST
DE
W
O
LF
E
ST
DE
W
O
LF
E
ST
DE
W
O
LF
E
ST
DE
W
O
LF
E
ST
DE
W
O
LF
E
ST

UPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDUPPER DWYER HILL RDOttawaOttawaOttawaOttawaOttawaOttawaOttawaOttawaOttawaMontagueMontagueMontagueMontagueMontagueMontagueMontagueMontagueMontague****/North ElmsleyDrummond/North ElmsleyDrummond/North ElmsleyDrummond/North ElmsleyDrummond/North ElmsleyDrummond/North ElmsleyDrummond/North ElmsleyDrummond/North ElmsleyDrummond/North ElmsleyBeckwithBeckwithBeckwithBeckwithBeckwithBeckwithBeckwithBeckwithBeckwith**** PlaceCarleton PlaceCarleton PlaceCarleton PlaceCarleton PlaceCarleton PlaceCarleton PlaceCarleton PlaceCarleton PlaceMississippi MillsMississippi MillsMississippi MillsMississippi MillsMississippi MillsMississippi MillsMississippi MillsMississippi MillsMississippi ****Lanark HighlandsLanark HighlandsLanark HighlandsLanark HighlandsLanark HighlandsLanark HighlandsLanark HighlandsLanark HighlandsLanark HighlandsFaradayFaradayFaradayFaradayFaradayFaradayFaradayFaradayFaradayBancroftBancroftBancroftBancroftBancroftBancroftBancroftBancroftBancroft****/MayoCarlow/MayoCarlow/MayoCarlow/MayoCarlow/MayoCarlow/MayoCarlow/MayoCarlow/MayoCarlow/Mayo**** HighlandsHastings HighlandsHastings HighlandsHastings HighlandsHastings HighlandsHastings HighlandsHastings HighlandsHastings HighlandsHastings HighlandsArnpriorArnpriorArnpriorArnpriorArnpriorArnpriorArnpriorArnpriorArnpriorGreater MadawaskaGreater MadawaskaGreater MadawaskaGreater MadawaskaGreater MadawaskaGreater MadawaskaGreater MadawaskaGreater MadawaskaGreater MadawaskaBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanBrudenell, Lyndoch and RaglanMadawaska ValleyMadawaska ValleyMadawaska ValleyMadawaska ValleyMadawaska ValleyMadawaska ValleyMadawaska ValleyMadawaska ValleyMadawaska ValleyBonnechere ValleyBonnechere ValleyBonnechere ValleyBonnechere ValleyBonnechere ValleyBonnechere ValleyBonnechere ValleyBonnechere ValleyBonnechere ValleyPikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Pikwakanagan (Golden **** 39)Admaston/BromleyAdmaston/BromleyAdmaston/BromleyAdmaston/BromleyAdmaston/BromleyAdmaston/BromleyAdmaston/BromleyAdmaston/BromleyAdmaston/BromleyHortonHortonHortonHortonHortonHortonHortonHortonHortonRenfrewRenfrewRenfrewRenfrewRenfrewRenfrewRenfrewRenfrewRenfrewWhitewater RegionWhitewater RegionWhitewater RegionWhitewater RegionWhitewater RegionWhitewater RegionWhitewater RegionWhitewater RegionWhitewater RegionPembrokePembrokePembrokePembrokePembrokePembrokePembrokePembrokePembrokeLaurentian HillsLaurentian HillsLaurentian HillsLaurentian HillsLaurentian HillsLaurentian HillsLaurentian HillsLaurentian HillsLaurentian Hills**** RiverDeep RiverDeep RiverDeep RiverDeep RiverDeep RiverDeep RiverDeep RiverDeep River****, **** and MariaHead, **** and MariaHead, **** and MariaHead, **** and MariaHead, **** and MariaHead, **** and MariaHead, **** and MariaHead, **** and MariaHead, **** and ******** AlgonquinSouth AlgonquinSouth AlgonquinSouth AlgonquinSouth AlgonquinSouth AlgonquinSouth AlgonquinSouth AlgonquinSouth Algonquin290-1290-1290-1290-1290-1290-1290-1290-1290-1LegendLegendCopyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007Copyright of Bell Canada© 2007L'information ci-incluse est le copyright deBell Canada© 2007, et ne peut être physiquement,électroniquement ou mécaniquement reproduiteen tout ou en partie ou pour tout dérivé.

Digital Topographic Data produced under licencefrom Her Majesty the Queen in the Right of Canadawith permission from the Natural Resources Canada.

The information contained herein is copyright ofBell Canada© 2007, and may not be physically, electronically or mechanically duplicated in whole or in part or for any derivative.

Produit par Bell Canada, **** 2007Product of Bell Canada, **** 2007Information confidentielle / Restricted information2007 CanMap TM.

Source: DMTI Spatial Inc.

For more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticFor more information on this map or other geomaticservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact bis.support@bell.caservices, please contact ******@***.comMap produced: **** 2007Ref. N 00_0000Distribution Serving Areas (DSAs)proposed for Years 1 to 5 of theBroadband Expansion ProgramMap2613

Broadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramBroadband Expansion ProgramNPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 2NPA 613 - Map 25 0 5 10 15KilometersThe geographical view of the broadbandexpansion program have been approximated usingBell Canada’s and Bell Aliant’s distribution servingarea (DSA) boundaries.

In no event will Bell Canada, Bell Aliant or its affiliates be liable to any corporation or person for any damagesarising from the use of this document or any information contained therein.

Bell Canada Year 1NPA BoundariesBell Aliant Year 1Municipal BoundaryIndependent Telco Wire CenterBoundariesWater FeaturesBell Canada Years 2 to 5Bell Aliant Years 2 to 5F

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\¼

(

Schools****EmergencyRoadsBell Canada & Bell AliantWire Center BoundariesGolf CourseAreas not included inthe Broadband expansion programTown/Village nameForesters ****ChenauxBell FTTN:

45.6644826,-76.7651211 Installed after Sept 2012 EORN 2014 Final Report **** 28Click pictures and text for embedded linksAttachment A - **** Adams, Intervener CRTC 2015-134CRTC 2008-1, Cobden, Bell DSA 285-1https://www.google.ca/maps/place/Wilderness+Tours/@45.6660002,-76.7326541,15z/data=!4m2!3m1!1s0x4cd168c8816f3319:0x3b735b47fe50a7eahttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qdVBYMFY5Nzd1aW8/view?usp=sharinghttps://www.google.ca/maps/@45.6644826,-76.7651211,3a,75y,342.38h,69.98t/data=!3m6!1e1!3m4!1sEtF2SshHu63E5sjTDreWDw!2e0!7i13312!8i6656!6m1!1e1https://drive.google.com/file/d/0BwEjDkzP4A3qY0F1ckM3czFwWFE/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qNVFNQnhELVozZDg/view?usp=sharinghttps://services.crtc.gc.ca/Pub/ListeInterventionList/Documents.aspx?ID=221977&en=2015-134&dt=i&lang=e&S=O&PA=t&PT=nc&PST=ahttps://drive.google.com/file/d/0BwEjDkzP4A3qMjZuTFk2WWpXUzQ/view?usp=sharingBEP NPA 613 – Map 2 – 613_map2.pdfPembroke Bell DSA 403-0 – CRTC 2008-1 Lat/Long:

Tower 1 - 45°47’08.7"N 77°13’44.8"W Tower 2 - 45°47’00.9"N 77°14'20.3"WAttachment B - **** Adams, Intervener CRTC 2015-134CRTC **** ID 722533Click pictures and text for embedded linksLaurentian Valley Petawawa Broadband Initiative as detailed by Pembroke Daily Observer [Sean ****] [06 Oct 10]https://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://goo.gl/maps/RsRnaHUXeuvhttps://goo.gl/maps/jgtBheKn3nrhttps://services.crtc.gc.ca/Pub/ListeInterventionList/Documents.aspx?ID=221977&en=2015-134&dt=i&lang=e&S=O&PA=t&PT=nc&PST=ahttps://drive.google.com/folderview?id=0BwEjDkzP4A3qT2ROODdBLWFjRDQ&usp=sharinghttps://drive.google.com/file/d/1wfcb4t99vgeC3CmHia6CXoyW8XmKRui2g1eatsEwDfu9AEvNXix6simQOHRB1Jly_5h3YHgPgcmmYSud/view?usp=sharingCRTC **** ID 722533BEP NPA 613 – Map 2 – 613_map2.pdfPembroke DSA 111-0 – CRTC 2008-1 & 2009-763 Lat/Long: 45°42'42.3"N 77°00’23.2"W **** Road Laurentian Valley Petawawa Broadband Initiative as detailed by Pembroke Daily Observer [Sean ****] [06 Oct 10]Attachment C - **** Adams, Intervener CRTC 2015-134Click pictures and text for embedded linkshttps://drive.google.com/folderview?id=0BwEjDkzP4A3qT2ROODdBLWFjRDQ&usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://drive.google.com/file/d/1wfcb4t99vgeC3CmHia6CXoyW8XmKRui2g1eatsEwDfu9AEvNXix6simQOHRB1Jly_5h3YHgPgcmmYSud/view?usp=sharinghttps://drive.google.com/file/d/0BwEjDkzP4A3qRzRhY0NaQlg5UnM/view?usp=sharinghttps://goo.gl/maps/xSjHjyJ9i8G2https://services.crtc.gc.ca/Pub/ListeInterventionList/Documents.aspx?ID=221977&en=2015-134&dt=i&lang=e&S=O&PA=t&PT=nc&PST=a